No preview available
HomeMy WebLinkAboutPacket - 09/08/2020 - City Council4..... McHenr i AGENDA REGULAR CITY COUNCIL MEETING Tuesday, September 8, 2020, 7:00 p.m. In light of the current COVID-19 public health emergency, this meeting will be held remotely only. The public can observe by connecting online at: https://cityofmchenry.zoom.us/j/6088273734 The public can also call in to the following number: +1 312 626 6799, Meeting ID 608 827 3 734 1. Call to Order. 2. Roll Call. 3. Pledge of Allegiance. 4. Public Comments: If you wish to submit any public comment,please email: dmorefieldAcityofmchenry.org in advance of the meeting. The City will read such public comments during the public commentary portion of the meeting and the comments will be entered into the official record of the meeting. Any comments received during the meeting will be provided in writing to the Council after the meeting. 5. Consent Agenda: Motion to Approve the Following Consent Agenda Items: A. An Ordinance Pertaining to the Local Cure Program; (Morefield) B. Rejection of all bids received for the 2020 Fall Street Sweeping Program; (Strange) C. Motion to authorize the Mayor's execution of an amended Intergovernmental Agreement between the City of McHenry Division of Transportation and the City of McHenry for Phase I Engineering and authorization for staff to accept the transfer of the project lead to McHenry County upon execution for the Bull Valley Multi-Use Path Project; (Strange) D. Motion to approve Services Change Order#2 for the Bull Valley Bike Path to Hampton,Lenzini and Renwick, Inc. in the amount of$48,634.12; (Strange) E. McHenry Parks &Recreation Facilities & Special Use Permit Requests; (Hobson) F. August 17, 2020, City Council Meeting Minutes; G. Issuance of Checks in the amount of$600,914.79. 6. Individual Action Item Agenda A. Motion to approve the transfer of a Class C Liquor License from JOG Gasoline Inc, located at 4608 W. Crystal Lake Road,to Pazo Oil LLC. (Jett) B. Motion to approve Ordinances granting a Conditional Use Permit to allow Outdoor Storage in conjunction with a towing business at 1302 Borden Street. (Polerecky) C. Motion to approve and execute a Commercial Tenant Incentive Grant in the amount of$10,000 to Miller's Diner, located at 3918 Main Street. (Martin) D. Motion to approve and execute a Commercial Tenant Incentive Grant in the amount of$5,000 to Pineapple X-Pressed, located at 1104 N.Green Street. (Martin) The City of McHenry is dedicated to providing its citizens, businesses,and visitors with the highest quality ofprograms and services in a customer-oriented, efficient, andfiscaly responsible manner. k) MCHerZ E. Motion to approve Ordinances annexing currently unincorporated parcels at 202 Barreville Road, 219 Barreville Road, 223 Barreville Road, and the property located north of River Road and south of Elm Street. (Martin) 7. Discussion Items. A. Location of a marijuana dispensary at 408 State Route 31 (supplement provided; Martin/McArdle) B. Vacation of right of way in the Hanly Subdivision (supplement provided;Polerecky) C. Correction to December 2019 Update of Capital Development Fee Structure (supplement provided;Polerecky) D. Issuance of Pension Obligation Bonds for Outstanding Police Pension Liability (no supplement; Lynch) 8. Staff Reports. A. Transmittal of FY20/21 1st Quarter Financial Report(Lynch) 9. Mayor's Report. 10. City Council Comments. 11. Executive Session if Needed. 12. Adjourn. The complete City Council packet is availableforreview online via the City website at www.citvofmchenrv.org. For further information,please contact the Office of the City Administrator at 815-363-2108. NOTICE: In compliance with the Americans with Disabilities Act(ADA), this and all other City Council meetings are located in facilities that are physically accessible to those who have disabilities. If additional accommodations are needed,please call the Office of the City Administrator at 815-363-2108 at least 72 hours prior to any meeting so that accommodations can be made. 4.e.....) Wayne Jett,Jr. Mayor City of McHenry McHenry Municipal Center 333 Green Street 2 McHenry, Illinois 60050 McHenr Phone: (815) 363-2100 www.cityofmchenry.org CONSENT AGENDA SUPPLEMENT DATE: September 8, 2020 TO:McHenry City Council FROM: Monte Johnson RE:DCEO's Local CURE program ATT: Ordinance, Agreement AGENDA ITEM SUMMARY: The Local Coronavirus Urgent Remediation Emergency (or Local CURE) Support Program Section 3-10 of Public Act 101-0636) is a support program for units of local government as defined by the Illinois Constitution. The Local CURE program is appropriated to the department under Section 5 of Article 30 of Public Act 101-0637 in State Fiscal Year 2021 for $250,000,000 and administrative rules for the program can be found under Title 14 III. Admin. Code Part 700. The Local CURE program: Is a local government assistance program which applies to all units of local government as defined by the Illinois Constitution) outside of Cook, Lake, Will, Kane, & DuPage counties. Is federally funded from the Coronavirus Relief Fund using dollars allocated to Illinois through the CARES Act. Will reimburse units of local government for costs that: o are necessary expenditures incurred due to the public health emergency with respect to COVID-19; o were not accounted for in the budget most recently approved as of March 27, 2020 (the date of enactment of the CARES Act) for the unit of local government; and o were incurred during the period beginning March 1, 2020 and ending December 30, 2020. The Ordinance is the approval by the corporate authorities to authorize the agreement. RECOMMENDATION: A motion to approve an Ordinance Pertaining to the Local Cure Program. The City of McHenry is dedicated to providing its citizens, businesses, and visitors with the highest quality ofprograms and services in a customer-oriented, efficient, and fiscally responsible manner. ORDINANCE NO. AN ORDINANCE PERTAINING TO THE LOCAL CURE PROGRAM WHEREAS, the City of McHenry, McHenry County, Illinois, McHenry is an Illinois municipality, eligible for reimbursement of funds through the Local Coronavirus Urgent Remediation Emergency Support Program (Local CURE Program), 20 ILCS 605/605-1045; and WHEREAS, the Local CURE Program is funded from financial assistance the State of Illinois received through the U.S. Department of the Treasury's Coronavirus Relief Fund (CFDA No. 21.019) authorized under section 601(a) of the Social Security Act, as added by section 5001 of the Coronavirus Aid, Relief and Economic Security Act, P.L. 116-136 ("CARES Act"); and WHEREAS, as a Local Government recipient of financial support through the Local CURE Program, the City is required to utilize the financial support received from the Illinois Department of Commerce and Economic Opportunity(the "Department") for the specific purposes and in compliance with the terms and certifications of the Local CURE Program; and WHEREAS, the corporate authorities of the City have determined that it is advisable, necessary and in the best interest of the City to enter into the attached Local CURE Program Financial Support Conditions and Certification in order to participate in and receive the funding pursuant to the Local CURE Program. NOW, THEREFORE, BE IT ORDAINED AS FOLLOWS: ARTICLE 1 The foregoing recitals shall be and are hereby incorporated as findings of fact as if said recitals were fully set forth herein. ARTICLE 2 The Financial Support Conditions and Certification in substantially the form of the exhibit attached hereto is hereby incorporated herein by reference, authorized and approved. ARTICLE 3 The Mayor is hereby authorized to execute and deliver and the City Clerk is hereby authorized to attest to said execution of said certification in substantially the form of the exhibit appended hereto as so authorized and approved for and on behalf of the City. ARTICLE 4 1 SEVERABILITY. If any provision of this Ordinance or application thereof to any person or circumstances is ruled unconstitutional or otherwise invalid, such invalidity shall not affect other provisions or applications of this Ordinance that can be given effect without the invalid application or provision, and each invalid provision or invalid application of this Ordinance is severable. ARTICLE 5 REPEAL OF CONFLICTING PROVISIONS. All ordinances and resolutions, or parts thereof, in conflict with the provisions of this Ordinance are, to the extent of the conflict, expressly repealed on the effective date of this Ordinance. ARTICLE 6 EFFECTIVE DATE. This Ordinance shall be in full force and effect on September 8, 2020. Passed this 8th day of September, 2020. Ayes Nays Absent Abstain Alderman Devine Alderman Glab Alderman Harding Alderman Mihevc Alderwoman Miller Alderman Santi Alderman Schaefer Wayne Jett, Mayor Trisha Ramel, City Clerk Mayor/Village President ATTEST: Clerk 2 Certification No.20-494608 LOCAL CORONAVIRUS URGENT REMEDIATION EMERGENCY SUPPORT PROGRAM Local CURE Program") FINANCIAL SUPPORT CONDITIONS AND CERTIFICATION City of McHenry("Local Government"),with its principal office at 333 S Green St,McHenry, IL 60050, is eligible to receive an amount not to exceed $1,113,502 ("allotment") as financial support pursuant to the Local CURE Program. The Local CURE Program is funded from financial assistance the State of Illinois received through the U.S. Department of the Treasury's Coronavirus Relief Fund (CFDA No. 21.019) authorized under section 601(a) of the Social Security Act,as added by section 5001 of the Coronavirus Aid, Relief and Economic Security Act,P.L. 116-136("CARES Act"). As a Local Government recipient of financial support through the Local CURE program,the Local Government is required to utilize the financial support received from the Illinois Department of Commerce and Economic Opportunity (the "Department") for the specific purposes as set forth below. To participate in the Local CURE Program, the Local Government must remain in compliance with the terms and certifications stated herein.Please review the items below carefully, as the Local Government and its representative shall warrant that all material facts presented are accurate. If the Local Government is unable to provide this assurance, it is ineligible to receive financial support under the Local CURE Program. The Department may enter into an agreement with one or more third parties to assist in the administration of the Local CURE Program.The Local Government shall adhere to all instructions or guidance issued by the Department's third party vendors in addition to those of the Department. The allowable uses of program funds and eligible expenditures set forth in this certification will be modified by the Department, in accordance with the Illinois Administrative Procedure Act, if the CARES Act or the U.S.Department of the Treasury guidance is amended to authorize different categories of eligible uses or eligible expenses. The Local Government should return this signed Financial Support Conditions and Certification by October 1,2020. FINANCIAL SUPPORT CONDITIONS As the authorized representative of the Local Government, I agree and certify that the Local Government: 1 General Information 1. Provided true and accurate information on the following documents, as applicable: the application and the IRS Form W-9. 2. Will have,by the time Local Government submits its first request for reimbursement,an active registration on the federal System for Award Management ("SAM") and will maintain an active SAM registration throughout the duration of the Local Government's participation in the Local CURE Program. 3. Is a"unit of local government" as defined by the Illinois Constitution,Article VII, Section 1 and has the legal authority to apply for and receive financial support under the Local CURE Program. 4. Is not located completely within one or more of the five Illinois counties that received direct allotments from the CARES Act fund (Cook,DuPage,Kane,Lake, or Will). Local CURE Program Requirements 5. Has incurred or will incur eligible costs,as defined by 14 Ill.Admin.Code Part 700,for which it will seek reimbursement from the Department under the Local CURE Program.Specifically, the costs incurred by the Local Government: a. are necessary expenditures incurred due to the public health emergency with respect to COVID-19; b. are not accounted for in the budget most recently approved as of March 27,2020(the date of enactment of the CARES Act)for the unit of local government;and c. were or will be incurred during the period that begins on March 1, 2020 and ends December 30,2020. 6. Understands that pursuant to the Local CURE Program, the Local Government will only be permitted to seek reimbursement from the Department for costs that have already been expended for services performed or goods received.No advance payments will be permitted. 7. Shall seek reimbursement from one or more of the following five categories of eligible incurred expenses: a. Medical expenses,including but not limited to:expenses of establishing temporary public medical facilities and other measures to increase COVID-19 treatment capacity,costs of providing COVID-19 testing,and emergency medical response expenses; b. Public health expenses, including but not limited to: expenses for communication and enforcement by local governments of public health orders related to COVID-19; c. Payroll expenses for public safety,public health,health care,human services,and similar employees whose services were substantially dedicated to mitigating or responding to COVID-19; d. Expenses for actions taken to facilitate compliance with COVID-19 related public health measures;and e. Any other COVID-19 related expenses reasonably necessary to the function of government,or for other uses approved by the Department,that satisfy the Local CURE Program eligibility criteria.The Local Government must document how expenses are related to COVID-19. 2 8. Understands that to be eligible for reimbursement, the Local Government must have had services performed or received goods to respond directly to the public health emergency with respect to COVID-19 by December 30,2020. 9. Understands that it is Local Government's responsibility to communicate with and report to the Department Local Government's needs regarding the allotment on a regular basis, as directed by the Department. This includes the requirement that Local Government report as soon as practicable if it believes that a portion of the allotment will not be utilized by the Local Government,OR if Local Government is in need of additional funds in excess of the allotment, for costs which will be incurred by December 30, 2020 and which will comply with all the Local CURE Program requirements. 10.Understands that on or around November 1,2020,the Department will send a notice to Local Government indicating that it must report in detail:(a)how Local Government intends to spend the remainder of the initial allotment, and (b) any anticipated eligible expenses through December 30,2020 in excess of the local government's initial allotment.If, by December 1, 2020, Local Government does not submit a report to the Department, or the detailed report submitted by Local Government reveals that some or all of the allotment will not be utilized by the Local Government, the Department will redirect, in accordance with 14 III. Admin. Code Part 700,the projected unspent balance to other local governments eligible for the Local CURE Program,which have reported a need for funds. 11.Understands that all requests for reimbursement for any Local CURE Program allotment received by Local Government before February 1, 2021 must be received by the Department or its third party administrator by January 31,2021, 12.Understands that if Local Government's allotment has a remaining balance of funds for which Local Government has not sought reimbursement by January 31,2021,on February 1,2021, the remaining balance will be redirected to one or more local governments eligible for the Local CURE Program,which have a need for funds. 13.Understands that if the Local Government receives an allotment on or after February 1,2021, the Local Government must submit all requests for reimbursement for this allotment to the Department or its third party administrator by February 28,2021. 14. Understands that for any allotment received by Local Government on or after December 1, 2020, to be eligible for reimbursement, the Local Government must have had services performed or received goods to respond directly to the public health emergency with respect to COVID-19 by December 30,2020. 15. Understands that the Local Government will submit to the Department or its third party administrator requests for reimbursement on forms provided by the Department or its third party administrator, including all required supporting documentation and in the manner requested by the Department or third party administrator,that the third party administrator will review the information received for eligibility,and if approved,the payment(s)will be released by the Department to the Local Government. 16. Understands that funds received through the Local CURE Program may not be used to fill shortfalls in the Local Government's revenue to cover expenditures that would not otherwise qualify under the program unless the Department authorizes such expenditures, in accordance with the Illinois Administrative Procedure Act, after a modification to the CARES Act or subsequent guidance issued by the U.S. Department of the Treasury. 3 17. Shall not seek reimbursement for incurred expenses under the Local CURE Program for which the Local Government has received or will receive a duplicate benefit through another State or federal funding opportunity. 18. Understands that any funding provided through the Local CURE Program is authorized under section 601(a) of the Social Security Act, as added by section 5001 of the CARES Act. The Local Government shall follow all requirements of the CARES Act, including,but not limited to,all related guidance, including subsequent guidance, issued by the U.S. Department of the Treasury. 19. Shall use the funds received from the Department in accordance with the requirements of the Local CURE Program, including the statute (20 ILCS 605/605-1045), rules (14 Ill. Admin. Code Part 700), including any amendments thereto, and all written guidance and manuals issued by the Department and/or its third party administrator. The Department, as the administrator of the Local CURE Program, has the authority to take any action necessary to bring Local Government into compliance with the program requirements. 20.Understands that the Department reserves the right to seek a refund from the Local Government if the Department, another State agency or the federal government finds that the Local Government:(a)made a false or fraudulent statement to the Department or its third party administrator; (b) made a false or fraudulent claim for funds; or (c) spent the Local CURE Program funds on ineligible expenses or for duplicate costs that were reimbursed through another federal or State program. Local CURE Program Administrative Requirements 21. Shall provide all necessary forms, documentation and information as required or requested by the Department or its third party administrator(s)to operate the Local CURE Program. 22. Shall submit all required reports and information requested by the Department or the third party administrator including, but not limited to, information demonstrating funds received under the Local CURE Program were deposited in an account held by the Local Government. 23. When requesting a reimbursement, shall submit a report certifying the costs,as required by 2 CFR 200.415,and provide all documentation and information required by 14 Ill.Admin. Code Part 700, and any other information requested by the Department or its third party administrator. 24. Shall include Local CURE funding in the applicable financial statement and/or audit of the Local Government, including a Single Audit pursuant to the Single Audit Act (31 U.S.C. 7501-7507). 25. Shall not seek reimbursement for costs paid to an entity on the federal or State debarred and suspended list. 26, Shall comply with the following provisions of the Uniform Administrative Requirements, Cost Principles, and Audit Requirements for Federal Awards(2 CFR Part 200):2 CFR 200.303 regarding internal controls;2 CFR 200.330 through 200.332 regarding subrecipient monitoring and management;subpart E regarding cost eligibility requirements; and subpart F regarding audit requirements. 4 General Administrative Requirements 27. Is complying with all relevant State and federal laws and regulations. 28. And its affiliate(s), is/are not barred from receiving the Local CURE Program funds because the Local Government, or its affiliate(s), is/are delinquent in the payment of any debt to the State,unless the Local Government,or its affiliate(s),has/have entered into a deferred payment plan to pay off the debt, and the Local Government acknowledges the Department may terminate and/or seek a refund of the Local Government's Local CURE Program allotment if this certification is false(30 ILCS 500/50-11). 29. Shall continue to comply, as applicable,with the provisions of the Contract Work Hours and Safety Standards Act(40 U.S.C. 327-333), the Copeland Act(40 U.S.C. 276c and 18 U.S.C. 874),the Davis-Bacon Act(40 U.S.C.276a-276-1),the Drug-Free Workplace Act of 1988 (44 CFR, Part 17, Subpart F), the Fair Labor Standards Act (29 U.S.C. 201), and the Illinois Prevailing Wage Act(820 ILCS 130/1). 30. Shall comply with all relevant laws and regulations concerning non-discrimination. 31. Shall pay no appropriated funds to any person for influencing or attempting to influence an officer or employee of federal, State or local government,or an employee of a member of any federal, State or local government in connection with the awarding of any State and federal contract,the making of any State and federal grant,the making of any State and federal loan, the entering into any cooperative agreement, and the extension, continuation, renewal, amendment, or modification of any State and federal contract, grant, loan or cooperative agreement. 32. Shall prohibit employees, contractors, and subcontractors from using their positions for a purpose that constitutes or presents an appearance of personal or organizational conflict of interests or personal gain. 33. Has no action, lawsuit or proceeding pending or, to the knowledge of the Local Government, threatened which questions the legality or propriety of the transactions contemplated by the receipt of funds through the Local CURE Program or which will have a material adverse effect on the performance required by the Local Government. 34. Has not received any notice of any investigation conducted or charges, complaints or actions brought by the State of Illinois or any governmental body within the State of Illinois regarding the Local Government or its principals and key personnel that will be involved in the use of the Local CURE Program funds received. 35.Has not received any notice that any of its principals or key personnel that will be involved in the use of the Local CURE Program funds are the subject of any criminal investigations or charges. 36.Understands that neither the Department nor the Local Government shall be liable for actions chargeable to the other party related to the Department's provision of funds to the Local Government including,but not limited to,the negligent acts and omissions of a patty's agents, employees or subcontractors in the performance of their duties,unless such liability is imposed by law. 37. Understands that receiving funds pursuant to the Local CURE Program is contingent upon and subject to the availability of sufficient funds. The Department may terminate or suspend the Local Government's allotment, in whole or in part,without penalty or further payment being required, if(i)sufficient funds have not been appropriated or otherwise made available to the Department by the State or the federal funding source, (ii) the Governor or the Department 5 reserves funds, or(iii) the Governor or the Department determines that funds will not or may not be available for payment. The Department shall provide notice, in writing, to the Local Government of any such funding failure and its election to terminate or suspend Local Government's allotment as soon as practicable.Any suspension or termination pursuant to this paragraph will be effective upon the date of the written notice unless otherwise indicated. Accessibility of Records and Retention 38. Shall make books, records, related papers, supporting documentation, financial records and personnel relevant to the Local CURE Program available to authorized Department representatives, the Illinois Auditor General, Illinois Attorney General, any Executive Inspector General, federal authorities, and any other person as may be authorized by the Department (including auditors), by the State of Illinois or by federal statute. Local Government shall cooperate fully in any such audit or inquiry. Failure by the Local Government to maintain books,records,financial records and supporting documentation shall establish a presumption in favor of the State for the recovery of any funds paid by the State under the Local CURE Program for which adequate books, records, financial records and supporting documentation are not available to support disbursement. 39. Understands that the Department or its third party administrator will conduct monitoring of the Local CURE Program to ensure funds were spent in accordance with the Local CURE Program statute and the administrative rules. 40. Shall provide to any agent authorized by the Department,upon presentation of credentials, full access to, and the right to examine, any document,papers and records either in hard copy or electronic format,of the Local Government involving transactions related to the Local CURE Program. 41. Shall maintain for five (5) years from the date of submission of the final request for reimbursement, adequate books, all financial records and supporting documents, statistical records and all other records pertinent to the Local CURE Program. If any litigation, claim or audit is started before the expiration of the retention period,the records must be retained until all litigation, claims or audit exceptions involving the records have been resolved and final action taken. Other Expenditures Prohibited by the CARES Act 42. Shall not seek reimbursement under the Local CURE Program for expenditures prohibited by section 5001(b)of the CARES Act, including,but not limited to: a. advocacy for the legalization of any drug or other substance included in Schedule I of the schedules of controlled substances established under Section 202 of the Controlled Substances Act; b. dissemination of deliberately false or misleading scientific information; c, lobbying;or d. expenses for an elective abortion or on research in which a human embryo is destroyed, discarded, or knowingly subjected to risk of injury or death. The prohibition on payment for abortions does not apply to an abortion if the pregnancy is the result of an act of rape or incest; or in the case where a woman suffers from a physical disorder, physical injury, or physical illness, including a life-endangering physical condition 6 Primary Local Government Contact for Local CURE Program Name: Cro'yr rich Title: fMA Dt recto r Address: 333 S. Grew S--- McfMii j IL b 0 0 50 Phone: $ IS SG 3 2 I I 1 E-mail: Gty of atOkictvy , dr i. 8 caused by or arising from the pregnancy itself, that would,as certified by a physician, place the woman in danger of death unless an abortion is performed. Please Answer the Following Questions: 1. Does the Local Government intend to use the full allotment of funds set forth in the first paragraph,above? Yes No a. If yes, the Local Government agrees that it shall notify the Department as soon as practicable if the Local Government determines that it will not use its full allotment. b. If no, approximately,how much of the allotment does the Local Government plan to use?$OD/ 0 OD 2. Does the Local Government have or estimate it will have additional Local CURE Program eligible expenses greater than the allotment set forth in the first paragraph, above? Yes XNo a. If yes, please provide an estimate of the additional funds needed and the types of expenses generally. 3. Does the Local Government plan to use any of the funds received through the Local CURE program from the Department as a required match component for another State or federal program? Yeso a. If yes,please describe the program(s). CERTIFICATION The individual below, acting in the capacity to represent the Local Government in completion of this certification,certifies that all information contained herein, is true to the best of his/her knowledge and belief. I declare under penalty of perjury that the above statements are true and correct. Authorized Representative Wayne Jett, Mayor Sign r Name &Title Date W ¢• - (-@ ei+1oc lvtclnenty o r3E-mail 36-6005993 065244878 Local Government FEIN Local Government DUNS Number 7 Department of Public Works Troy Strange, P.E., Director of Public Works 1415 Industrial Drive McHenry, Illinois 60050 Phone: (815) 363-2186 Fax: (815) 363-2214 McHenrwww.cityofmchenry.org CONSENT AGENDA SUPPLEMENT DATE: September 8, 2020 TO:Mayor and City Council FROM: Troy Strange, P.E., Director of Public Works RE:2020 Fall Street Sweeping Program, Rejection of Bids ATT: As Read Tabulation of Bids AGENDA ITEM SUMMARY: Staff requests City Council to consider the rejection of all bids for the 2020 Fall Street Sweeping Program. BACKGROUND: FY20/21 Public Works Street Division Operating Budget originally included $85,000 for contracted street sweeping services. This change was made in FY19/20 due to the poor operating condition of the current street sweeping unit owned and operated by the Public Works Department and the greater ability of contracted services to perform fall sweeping services after the falling of leaves. Staff prepared bid documents and released the program for bid at the beginning of August. On August 26, 2020, two (2) bids were received for the 2020 Fall Street Sweeping Program. Bids ranged from $37,164.00 to $54,000.00 for the Base Bid. Bids ranged from $46,944.00 to $57,200.00 for the Bid Alternate. ANALYSIS: Staff has analyzed bids and has found them to be accurate. However, due to recent revenue projections staff has taken initiative to cut as many deferrable contractual expenditures as is reasonable while still delivering adequate services. The City of McHenry is dedicated to providing the citizens, businesses and visitors of McHenry with the highest quality of programs and services in a customer-oriented,efficient and fiscally responsible manner. RECOMMENDATION: Therefore, if Council concurs, it is recommended to reject all bids for the 2020 Fall Street Sweeping Program. The City of McHenry is dedicated to providing the citizens,businesses and visitors of McHenry with the highest quality of programs and services in a customer-oriented,efficient and fiscally responsible manner. 41) McHenr Name of Bidder: Lakeshore Recycling Systems- Prairieland Disposal Inc. CleanSweep Division Tabulation of Bids Date: 8/26/2020 Time:1:00 PM 6132 Oakton Street 21N988 Pepper Road Morton Grove, IL 60053 Lake Barrington, IL 60010 City of McHenry Proposal Guarantee:Bid Bond Bid Bond Fall 2020 Street Sweeping Program Item Item Unit Quantity Unit Price Total Unit Price Total 1 Base Bid,City Dump Site 1 Complete Cycle 4 9,291.00 $ 37,164.00 $ 13,500.00 $ 54,000.00 2 Alternate Bid,Contractor Dump Site 1 Complete Cycle 4 11,736.00 $ 46.944.00 S 14,300.00 $ 57,200.00 Total Bid: As Read: 37,164.00 54,000.00 As Calculated: 37,164.00 54,000.00 LOW BID 4.7)^,,, Department of Public Works Troy Strange, P.E., Director of Public Works 1415 Industrial Drive McHenry, Illinois 60050 Phone: (815) 363-2186 Fax: (815) 363-2214 McHenrwww.cityofmchenry.org CONSENT AGENDA SUPPLEMENT DATE: September 8, 2020 TO:Mayor and City Council FROM: Troy Strange, P.E., Director of Public Works RE:Bull Valley Multi-Use Path Project Revised Inter-Governmental Agreement ATT: Amended Inter-Governmental Agreement as approved by McHenry County Board Project Location Map Executed McHenry County Board Resolution Approving IGA Revision AGENDA ITEM SUMMARY: Staff requests City Council to authorize the Mayor to execute an amended Inter-Governmental Agreement (IGA) between McHenry County Division of Transportation (MCDOT) and the City of McHenry for Phase I Engineering for the Bull Valley Road Multi Use Path. Staff further requests City Council authorize staff to accept the transfer of project lead to McHenry County upon execution of the amended agreement. BACKGROUND: In 2017, City Staff and MCDOT began discussions for a joint effort to begin preliminary engineering for the Bull Valley Multi-Use Path project. This project, when completed, will complete a multi-use path alignment which connects Moraine Hills State Park with the McHenry County Conservation District Prairie Path. At the November 6, 2017 City Council meeting an IGA for the completion of Phase I Engineering Services for the Bull Valley Road Multi Use Path was approved by City Council. In this IGA, City staff were identified as the project lead and staff began the consultant selection process shortly thereafter. At the March 19, 2018 City Council Meeting, City Council awarded a contract for Phase 1 Professional Engineering Services for the Bull Valley Multi Use Path project to Hampton Lenzini and Renwick, Inc. (HLR). For the past two years, staff has been managing HLR and acting as liaison to MCDOT while leading Phase I services for this project. Since the kickoff of this project there have been several developments which have created a necessity for MCDOT to consider the future buildout of the roadway in addition to the completion of the path. One consideration is the premature failure The City of McHenry is dedicated to providing the citizens,businesses and visitors of McHenry with the highest quality of programs and services in a customer-oriented,efficient and fiscally responsible manner. of a large culvert which crosses the proposed alignment of the path. Additionally, the Chicago Metropolitan Agency for Planning (CMAP) released new traffic projections which have made the future buildout of the five lane roadway a consideration with regard to the completion of the multi-use path. This project also includes a railroad crossing for which MCDOT would prefer to act as the lead agency with regard to railroad coordination. MCDOT originally approved an amended IGA in June of 2019 which reflected an addition of language regarding railroad coordination. This IGA was never approved at the City Council level because by that time staff had begun discussions to transfer the overall lead on the project to MCDOT. City Staff and MCDOT have concluded that the proper hierarchy for project coordination should put MCDOT in the overall lead for the project. This can be accomplished by City Council approving the amended IGA from June of 2019 and at that point MCDOT will administratively amend the agreement to accept the overall lead on the project. This amended IGA remains consistent with regard to the City's original commitment for financial participation in the project while placing MCDOT in the lead for overall project coordination. ANALYSIS: Staff and City Attorney have reviewed the amended IGA and have found the agreement to be acceptable. Due to the concerns related to the long term roadway design of the County Highway, Staff have deemed the transfer of project lead to MCDOT. RECOMMENDATION: Therefore if Council concurs, staff recommends that City Council authorize the Mayor to execute an amended Inter-Governmental Agreement between McHenry County Division of Transportation and the City of McHenry for Phase I Engineering for the Bull Valley Multi-Use Path Project. Staff further recommends that City Council authorize staff to accept the transfer of project lead to McHenry County upon execution of the amended agreement. The City of McHenry is dedicated to providing the citizens,businesses and visitors of McHenry with the highest quality of programs and services in a customer-oriented,efficient and fiscally responsible manner. INTERGOVERNMENTAL AGREEMENT BETWEEN THE COUNTY OF MCHENRY AND THE CITY OF MCHENRY FOR PHASE I ENGINEERING OF A SHARED USE AND RAILROAD COORDINATION FOR A PATH ALONG BULL VALLEY ROAD AND ASSOCIATED IMPROVEMENTS THIS AGREEMENT entered into this day of 2017 and between the County of McHenry, Illinois, a body politic and corporate, acting by and through its County Board, hereinafter referred to as the COUNTY, and the City of McHenry, a municipal corporation, acting by and through its City Council, hereinafter referred to as the CITY. WITNESSETH WHEREAS,the COUNTY has jurisdiction over Bull Valley Road in the City of McHenry,from Crystal Lake Road to Illinois Route 31; and WHEREAS,the Prairie Trail is an existing regional shared use path maintained by the McHenry County Conservation District and crosses Bull Valley Road east of Kresswood Drive; and WHEREAS, a shared use path maintained by the CITY also exists along Charles J. Miller Road, from Illinois Route 31 to River Road; and WHEREAS, a gap exists in the regional trail network between the Prairie Trail and Illinois Route 31; and WHEREAS,the COUNTY and the CITY desire to construct a shared use path to become a new portion of the regional trail network which will fill such gap; and WHEREAS, completing this gap in the regional trail network with a shared use path with safe and accessible crossings will connect residents to numerous key locations such as Centegra Medical Center, McHenry City Hall and Moraine Hills State Park; and WHEREAS, the CITY and the COUNTY have developed a plan to complete Phase I engineering for the improvements for the shared use path as described in the attached Exhibit A, hereinafter referred to as the ENGINEERING; and WHEREAS,the CITY and the COUNTY agree to coordinate a new pedestrian crossing with the Union Pacific Railroad as described in the attached Exhibit A, hereinafter referred to as the RAILROAD; and WHEREAS, the total costs associated with Phase I ENGINEERING, hereinafter referred to as the COSTS, is estimated to be $187,500; and WHEREAS,the COUNTY and the CITY intend to jointly apply for State and Federal funding for future phases of design engineering, construction, and construction engineering, including, but not limited to, the Illinois Transportation Enhancement Program (ITEP) and Transportation Alternatives Program TAP) federal grants 1 WHEREAS, the COUNTY and the CITY desire to reach an agreement regarding the funding of the COSTS; and WHEREAS, the COUNTY and the CITY are authorized by the terms and provisions of Section 10 of Article VII of the Illinois Constitution and the Intergovernmental Cooperation Act, 5 ILCS 220/1 et seq., to enter into intergovernmental agreements, ventures, and undertakings to perform jointly any governmental purpose or undertaking any of them could do singularly; NOW,THEREFORE, in consideration of the mutual covenants contained herein,the COUNTY and the CITY hereby mutually agree to perform as follows: 1. Recitals. The foregoing recitals are hereby incorporated and made part of this agreement as though fully set forth herein. 2. Lead Agency Engineering. The CITY shall serve as the lead agency coordinating the ENGINEERING. The ENGINEERING is designated in Exhibit A. 3. Lead Agency UPRR Coordination. The COUNTY shall serve as the lead agency coordinating with the RAILROAD. The RAILROAD is designated in Exhibit A. 4. Cost Participation. The estimated COSTS associated with the ENGINEERING and RAILROAD are $187,500. The COUNTY shall reimburse the CITY for 80% of the actual COSTS consisting of the Phase I design ENGINEERING and the CITY shall pay the remaining 20%of the actual COSTS consisting of the design ENGINEERING.The CITY shall credit the COUNTY for 20%of the actual COSTS consisting of the RAILROAD and the COUNTY shall pay the remaining 80%of the actual COSTS consisting of the RAILROAD. a. COUNTY Portion. The COUNTY's estimated portion of the COSTS for Phase I design ENGINEERING and RAILROAD is $150,000. b. CITY Portion. The CITY's estimated portion of the COSTS for Phase I design ENGINEERING and RAILROAD is $37,500. The CITY shall require as part of the ENGINEERING that updated estimated COSTS shall be provided no less than bi-weekly and agrees to provide the COUNTY with said information. The parties agree that should any updated estimated COSTS of the ENGINEERING exceed the original estimate,as stated herein,by more than ten percent(10%),either party may terminate this agreement without penalty or expense to any party upon written notification. However, the indemnification provisions of Sections 9 and 10 shall survive such termination for any claims or other matters that may have arisen prior to such termination. Any COSTS incurred prior to the termination shall be paid according to the allocations set forth above. 5. Solicitation Approvals. The CITY shall provide the COUNTY any proposed solicitation to select engineers or an engineering firm to develop the ENGINEERING of the shared use path within fourteen (14) days of entering into this agreement for input and recommendations. The COUNTY shall review and either approve or provide recommendations to the CITY for proposed changes to the solicitation within twenty-one (21) days of receipt. The COUNTY's approvals shall not be unreasonably withheld. 2 6. UPRR Railroad Agreement. The COUNTY shall enter into a separate agreement with the RAILROAD. 7. Plan Approvals. The CITY shall provide the COUNTY all ENGINEERING for the shared use path within fourteen(14)days of receipt for input and recommendations.The COUNTY shall review and either approve or provide recommendations to the CITY for proposed changes to the ENGINEERING for the shared use path within twenty-one (21) days of receipt. The COUNTY's approvals shall not be unreasonably withheld. 8. Contract Approvals. Prior to entering into any contracts for ENGINEERING of the shared use path the CITY shall provide copies of such proposed contracts to the COUNTY within fourteen(14)days of receipt for review and approval. The COUNTY shall review and either approve or provide recommendations to the CITY for proposed changes to the proposed contracts within twenty-one 21) days of receipt. The COUNTY's approvals shall not be unreasonably withheld. 9. Contract Provisions. Any contract entered into by the CITY for ENGINEERING of the shared use path and RAILROAD shall contain and extend indemnification, insurance requirements, and warranties to the CITY and COUNTY. Certificates of insurance and insurance policy endorsements shall be required by the CITY of such contractors and shall name the COUNTY as additional insureds. 10. Indemnification by the COUNTY. The COUNTY agrees to indemnify, defend, and hold harmless the CITY, its elected officials, its duly appointed officials, agents, employees, and representatives, from and against any and all claims, suits, settlements, actions, losses, expenses, damages, injuries, judgments, and demands arising from the negligent actions of the COUNTY arising from, growing out of, or connected with the ENGINEERING of the shared use path and RAILROAD. 11. Indemnification by the CITY. The CITY agrees to indemnify, defend, and hold harmless the COUNTY, its elected officials, its duly appointed officials, agents, employees, and representatives, from and against any and all claims, suits, settlements, actions, losses, expenses, damages, injuries, judgments, and demands arising from the negligent actions of the CITY arising from, growing out of, or connected with the ENGINEERING of the shared use path and RAILROAD. 12. Limitation of Authority. It is mutually agreed by and between the parties hereto that nothing contained in this agreement is intended nor shall be construed in any manner or form to limit the power or authority of the COUNTY or the Director of Transportation/County Engineer to maintain, operate, improve, construct, re-construct, repair, build, widen, or expand any COUNTY Highway as best determined and provided by law. 13. Severability. It is mutually agreed by and between the parties hereto that the provisions of this agreement are severable. If any provision, paragraph, section, subdivision, clause,phrase, or word of this agreement is for any reason held to be contrary to law, or contrary to any rule or regulation having the force and effect of law, such decision shall not affect the remaining portions of this agreement. 3 14. Entire Agreement. It is mutually agreed by and between the parties hereto that the agreement of the parties hereto is contained herein, and that this agreement supersedes all oral agreements and negotiations between the parties hereto relating to the subject matter hereof as well as any previous agreements presently in effect between the parties hereto relating to the subject matter hereof. 15. Modifications. It is mutually agreed by and between the parties hereto that any alterations, amendments deletions, or waivers of any provision of this agreement shall be valid only when expressed in writing and duly executed by the parties hereto. 16. Successors and Assigns. This agreement shall be binding upon and inure to the benefit of the parties hereto,their successors and assigns,provided however,that no party hereto shall assign any interest hereunder without the prior written consent and approval of the others and any such assignment, without said prior written consent and approval shall be null and void and of no force and effect. 17. Rights of Third Parties. Nothing herein shall be construed to create any rights or duties to third parties, it being the parties' mutual intent that there be no third party beneficiaries to this agreement. Any allocation of costs,duties and responsibilities described herein is intended only as an allocation of administrative responsibilities between the COUNTY and the CITY to facilitate the most economical use of limited public resources and not as an enlargement or diminution of any party's underlying duties or obligations lying in statute or common law. 18. Notices. Any notices required or permitted hereunder shall be sufficiently given if mailed by certified mail, return receipt requested to the parties hereto as follow: MCHENRY COUNTY DIVISION OF TRANSPORTATION 16111 Nelson Road Woodstock, Illinois 60098 Attention: Mr. Joseph R. Korpalski, Jr., P.E. Director of Transportation/County Engineer CITY OF MCHENRY 333 Green Street McHenry, Illinois 60050 Attention: Mr. Jon Schmitt Public Works Director 19. Jurisdiction and Venue. The terms of this agreement will be construed in accordance with the laws of Illinois, and if any disputes arise, said disputes shall be decided under the jurisdiction and governed by the laws of Illinois. The venue for any disputes involving interpretations of this agreement shall be the 22nd Judicial Circuit of the State of Illinois, McHenry County, Illinois. 20. Authorized Signatory. Each person signing below on behalf of one of the parties hereto agrees, represents and warrants that he or she has been duly and validly authorized to sign this agreement on behalf of their party. 4 IN WITNESS WHEREOF, the parties have entered into this Agreement on the date set forth above. ATTEST: CITY OF MCHENRY Lynzi Nevitt, City Clerk Wayne S. Jett, Mayor City of McHenry City of McHenry ATTEST: COUNTY OF MCHENRY Joseph J. Tirio, Clerk Jack D. Franks, Chairman McHenry County McHenry County Board 5 R-201906-82-153 16.2 B 14' RESOLUTION RESOLUTION AMENDING AN INTERGOVERNMENTAL AGREEMENT WITH THE CITY OF MCHENRY FOR THE DESIGN OF A SHARED-USE PATH ALONG BULL VALLEY ROAD IN THE CITY OF MCHENRY WHEREAS,the City of McHenry and the County of McHenry desire to work collaboratively to complete a gap in the regional bicycle and pedestrian trail network that exists along Bull Valley Road in the City of McHenry;and WHEREAS,completing this gap will enhance mobility and safety for cyclists and pedestrians and will provide better accessibility to the Prairie Trail, Northwestern Medical McHenry Hospital, and Moraine Hills State Park; and WHEREAS,the County Board approved an intergovernmental agreement with the City of McHenry by resolution(R-201712-82-369)at their December 12,2017 meeting for an amount of 150,00.00 for Phase I Preliminary Engineering for said project; and WHEREAS, in order to complete the shared use path from Illinois Route 31 to the Prairie Trail, the path will have to traverse the railroad tracks near the connection with the Prairie Trail;and WHEREAS,the Union Pacific Railroad Company requires the County of McHenry to enter into an agreement for the costs of preliminary engineering and other preliminary costs for an at-grade pedestrian crossing; and WHEREAS,the County of McHenry has amended the intergovernmental agreement with the City of McHenry to reflect the necessary coordination with the railroad and additional costs and cost sharing to complete the Phase I Preliminary Engineering; and WHEREAS,the Transportation and Finance&Audit Committees of the County Board have reviewed the attached amended intergovernmental agreement between the County of McHenry and the City of McHenry for Phase I Preliminary Engineering of a shared use path along Bull Valley Road. NOW, THEREFORE BE IT RESOLVED, by the County Board of McHenry County, Illinois,that the amended Intergovernmental Agreement between the County of McHenry and the City of McHenry is hereby approved; and BE IT FURTHER RESOLVED that the Division of Transportation in conjunction with the State's Attorney's Office is authorized to negotiate the final terms of this agreement prior to execution by theCountyBoardChairman; and BE IT FURTHER RESOLVED,that this project is hereby designated as Section 18-00478-00-BT; and BE IT FURTHER RESOLVED,that the Chairman is hereby authorized to execute the necessarydocuments; and BE IT FURTHER RESOLVED,that the County Clerk is hereby authorized to distribute two(2) certified copies of this Resolution to the Director of Transportation/County Engineer. DATED at Woodstock, Illinois,this 18th day of June,A.D., 2019. 7756/RJBrazas Page 1 12,1Pa6ket Pg :182 Exhibit A Bull Valle Road Side Path Existing path yellow) 1 7 a......i , Installation of new path (red) I I t pis . 4 ' a t s. dl i f r - S ct. t fi 4- • Tie into existingMiller RoadNewADAcompliantrailroad1—L---•. ai - p•, ,, ' pedestrian improvements tcrossingandpedestrian signalsf: R-201906-82-153 7 6:1314,' D. Fr-n s, C -'.irman enry County Board ATTEST: r Jo .ph J. Ti lo, County Clerk ATTACHM>w TS: Bull Valley Road Bike Path City of McHenry Signed Agreement (PDF) Bull Valley Road Bike Path-City of McHenry Resolution PDF) Bull Valley Road Bike Path-City of McHenry Amended Agreement PDF) Bull Valley Road Bike Path-City of McHenry Amended Agreement Exhibit A PDF) Packet Pg 183 STATE OF ILLINOIS SS COUNTY OF MCHENRY ) 16.2:B.14 I,Joseph J Tirio,County Clerk within and for said County and State aforesaid,do hereby certify the attached to be a true and complete copy of Resolution R-201906-82-1 53;Amending an Intergovernmental Agreement with the City of McHenry for the Design of a Shared-Use Path Along Bull ValleyRoadintheCityofMcHenry, WHEREOF I have hereunto subscribed my hand and affixed the official seal of said County,at my officeinWoodstock,Illinois this 18th day of June,2019, 7/4 McHenry County Clerk Department of Public Works Oili ftTroy Strange, P.E., Director of Public Works 14 1415 Industrial Drive O'McHenry, Illinois 60050 Phone: (815) 363-2186 Fax: (815) 363-2214 1VIcHenr www.cityofmchenry.org NCIRT OP TNC•Ow RIVCw CONSENT AGENDA SUPPLEMENT DATE: September 8, 2020 TO:Mayor Jett and City Council FROM: Troy Strange, P.E., Director of Public Works RE:Bull Valley Road Bike Path —Engineering Supplement AU: Change Order#2 Project Location Map HLR Scope of Services Revision — February 2020 AGENDA ITEM SUMMARY: Staff requests City Council to consider approving the Bull Valley Road Bike Path — Phase I Engineering—February 2020—Scope of Services Revision for$48,634.12 to Hampton, Lenzini and Renwick, Inc. BACKGROUND: On November 6, 2017 City Council approved an Inter-Governmental Agreement (IGA) between the City of McHenry and McHenry County Division of Transportation for the completion of Phase I Engineering Services for the Bull Valley Road Multi-Use Path Project. The IGA outlined the conditions for the City of McHenry to serve as the Lead Agency for the Phase I Engineering portion of the project. Per the Intergovernmental Agreement with the County of McHenry, the cost of the Phase I engineering will be split 80(County)/20(City). The original project budget was 187,500 ($150,000 County, $37,500 City), which was reflected in the approved FY2018/2019 City Budget. A consultant was selected from the City pool of prequalified firms and on March 19, 2018, the City entered into a Professional Services Contract for the above referenced project. The services were for Phase I - Engineering for 0.80 miles of a 10' multi-use bike path located on the north side of Bull Valley Road between Rte-31 and Kresswood Drive. This section of bike path will link the Illinois Prairie Trial to the existing bike path on Charles Miller Road. Upon completion, there will be a continuous off-street bike path from Kresswood Drive to the Moraine Hills State Park. The City of McHenry is dedicated to providing the citizens,businesses and visitors of McHenry with the highest quality of programs and services in a customer-oriented,efficient and fiscally responsible manner. The consultant has completed the previous services outlined in the original agreement. Upon review of the Phase I engineering, the McHenry County Division of Transportation requested additional analysis relative to the creek crossing and the potential for a 5-line cross section to be constructed on Bull Valley Road,which may be constructed in approximately 10 years. The intent is that the bike path and creek crossing will be designed and constructed in a location compatible with the ultimate Bull Valley Road cross section. ANALYSIS: Staff and McHenry County DOT have checked the scope of work and recommends awarding the Professional Engineering Contract Additional Services to Hampton, Lenzini and Renwick, Inc. Based on the 80/20 split per the IGA, the City's portion of this additional services contract will be 9,726.82. The total value of the contract is as follows: Original Contract Value: 104,087.00 Change Order#1 — Lighting Scope Change 10,566.00 Change Order#2—Creek Crossing/Geometry 48,634.12 Total 163,287.12 The total adjusted contract cost to date for the project of $163,287.12 is within the original budget appropriation of$187,500.00. RECOMMENDATION: Therefore, if Council concurs, it is recommended to approve Services Change Order#2 for the Bull Valley Road Bike Path to Hampton, Lenzini and Renwick, Inc. in the amount of$48,634.12. The City of McHenry is dedicated to providing the citizens, businesses and visitors of McHenry with the highest quality of programs and services in a customer-oriented,efficient and fiscally responsible manner. ATTACHMENT A SERVICES CHANGE ORDER NO. 2 In accordance with Section 4.1 of the Contract dated March 19 2018 between the City and the Consultant,the Parties agree to the following Services Change Order: 1. Change in Services: Additional creek crossing analysis and geometry analysis per Scope of Services Revisions—February 2020. 2. Change in Project Schedule(attach schedule ifappropriate): An additional 14 months from authorization to proceed. 3. Change in Completion Date: All Services must be completed on or before: 4. Change in Compensation: Additional compensation on a Time&Material basis not to exceed 48,634.12. ALL OTHER TERMS AND CONDITIONS OF THE CONTRACT REMAIN UNCHANGED. CITY CONSULTANT City's project representative] Signature Name(Printed or Typed) 20 20 Date Date If compensation change greater than$3,500,then City Administrator signature required. 20 . City Administrator Date If compensation change greater than$10,000,then City Council approval and Mayor signature required. 20 . Mayor Date 1- Exhibit A LOCATION MAP Bull Valle Road Side Path Existing path yellow) Installation of new path (red) g.. Fr AW-4 1 - v._ -, gr. i , 10, it Elf_- Tie into existing Miller Road • — New ADA compliant railroad J=-, u ow_fi-- , pedestrian improvements crossing and pedestrian signals r Bull Valley Road Bike Path - Phase I Engineering- February 2020 Scope of Services Revisions The City of McHenry has added revising the bike path to accommodate a 5-lane cross section of Bull Valley Road at the Union Pacific Railroad and the culvert to the scope of work for the Bull Valley Road bike path Phase I project. The stream crossing options have also changed; removing the culvert extension option and adding a single span bridge. Below is the original scope of work with revisions or additions shown in bold italic text. IEarly Coordination &Data Collection Initial Coordination and Project Start-up—We will attend and participate in a kick-off meeting with the City and IDOT to review desired outcomes, potential issues, and schedule.We will also provide the City with monthly status updates. Our team will field inspect the site to confirm topographic survey requirements, check as-built plans against actual conditions, and take photos.We will also obtain and review any existing or proposed studies on file. Field and Topographical Surveys Topographic Survey —We will complete a topographic survey upon receiving authorization to proceed. The route survey will include cross sections at 50' intervals and all driveways from the edge of pavement to 20'beyond the right- of-way.We will also include cross sections at critical locations, shoulder, landscape items, and utilities. Stream Survey—A stream survey between all three sets of culverts (Bull Valley Road crossing and nearest crossings upstream and downstream). This includes stream cross sections at standard intervals. The terrain on the streams upstream and downstream are heavily wooded; also, the stream to the south is not clearly 2 defined and the cross sections will need to be wider than standard. An exhibit showing the necessary stream cross sections is attached. The survey will be completed in Spring before the leaves come in. Survey of Public and Private Utilities—All utilities, including complete manhole inspections will be completed as part of the topographic survey. Tree Survey—All trees located within 20'of the existing right-of-way will be identified by our environmental engineers and locations will be determined by the survey crew for inclusion in the existing conditions file. Right-of-way — We will locate visible property corners and establish the existing right-of-way based on record documents. Full adjacent property surveys and drain tile surveys are not required for Phase I of this project. Utility Coordination 3 Utility coordination will be done early in the Phase I process to ensure the project moves forward in a timely manner.A design-level JULIE request will be completed to determine which utilities are located within the project limits. Geotechnical Investigation&Geotechnical Reports Soil and Pavement Borings—Soil/pavement borings will be completed by our subconsultant, Rubino Engineering, 4 Inc. We propose 8 soil borings for the multi-use path. The results of CCDD testing and the IEPA LPC#662 and#663 are valid for 12- to 18-months from the testing date and should be completed during Phase II. We will order the environmental and historical database review for the area within the proposed project limits under the PESA task.This report and review is required for the IEPA LPC#662 and#663 permitting process. This database will be reviewed for Potentially Impacted Properties(PIPs). Bull Valley Road Bike Path - Phase I Engineering - February 2020 Environmental Studies Environmental Survey Request—We will complete all environmental surveys needed for the Phase I study and work with the design engineers to reduce environmental impacts.This project will require an IDOT ESR for state and federal funding, which includes studies for the Illinois Historic Preservation Agency for cultural resources, the Illinois Department of Natural Resources for State-listed threatened/endangered species, and the U.S. Fish and Wildlife Service for federally-listed threatened and/or endangered species. Special Waste—A Preliminary Environmental Site Assessment(PESA) Report will be prepared for the project limits. The UPRR crosses Bull Valley Road at the west edge of the project,which presents the risk for potentially contaminated soils.The most common contaminants found along rail corridors include:arsenic,metals,petroleum products,coal ash, and polynuclear aromatic hydrocarbons (PAHs). Other potential concerns are creosote from railroad ties, asbestos from roofing shingles, air compressors, transformers, capacitors, and mercury from combustion products/leaking gauges. The PESA will be prepared using historical and geological information. The methods used will be in accordance with A Manual for Conducting Preliminary Environmental Assessments for Illinois Department of Transportation Highway Projects (Erdmann et at., 1996)," and the "Bureau of Design and Environment (BDE) Guidance, Special Waste Procedures, February 2011."The PESA will include a database search, review of historical records,on-site evaluation, and review of other project conditions that may give insight into the existing environmental conditions along the route. Once the review is done, a written report will be completed and submitted as documentation to the on-site analysis. 5 This report will accompany site photographs, maps, and the above referenced documentation, which will be used to assist with the project evaluation and any applicable recommendations. Depending upon the PESA report results, soil sampling may be recommended. Typically, the soil samplings and Preliminary Site Investigation are completed in Phase II. Wetland Delineation and Report: The National Wetland Inventory map indicates the presence of four mapped wetlands or waterways, confirmed by our field site visit and aerial review. Therefore, we propose to complete a formal wetland delineation of the project area. The wetland delineations will be conducted to meet the requirements of Executive Order 11990, "Protection of Wetlands", Section 404 of the Federal Water Pollution Control Act as amended by the Clean Water Act(Corps of Engineers, Section 404 Permit), and IEPA Section 401 Guidelines regulations. A wetland delineation letter report will be prepared summarizing the findings of the fieldwork, including mitigation recommendations and options. The final determination of impacts and mitigation requirements will be coordinated through IDOT BDE and the Illinois Department of Natural Resources. If wetland mitigation is required,we will evaluate the feasibility of alternatives.The mitigation options include accumulation through IDNR,the purchase of wetland bank credits, or the design and construction of a wetland site. We will assist the City with obtaining wetland bank credits; however, if on-site wetland mitigation is needed, a separate proposal will be prepared. The wetland delineations will be summarized in the Wetland Impact Evaluation Forms(WIE). These documents will be submitted to IDOT for review. Tree Survey and Report:We will conduct a tree survey within the project limits to identify tree type, diameter, health, and structure. At tree survey report will be prepared according to IDOT requirements to identify impacted trees. Evaluation of bat habitat may also be required and can be completed with the tree survey. Drainage Studies Hydraulic Analysis of Box Culvert—HLR drainage personnel will perform a field visit to establish existing conditions and document unique site drainage characteristics.There will be continuous coordination between the drainage design needs and the geometric design of the multi-use path. It is expected that this project will be classified as a Public Road 6 Development under the McHenry County Stormwater Management Ordinance. However, we anticipate that the threshold of new impervious areas will not be exceeded and that stormwater storage will not be required. Flows to the culvert will be determined using UGSS Stream Stats. These flows will be modeled through the existing and proposed culvert alternates using FHWA's HY-8 Culvert Hydraulic Analysis program.A cursory review of the culvert indicates that it would be hydraulically adequate if extended. The original scope of work included extending the culvert, replacing the culvert and a separate path structure. Bull Valley Road Bike Path - Phase I Engineering- February 2020 Drainage Studies(continued) This separate structure was assumed to be a drop-in place,pre-formed bridge,with all plans and specifications provided by the manufacturer.For this type of structure,a Type,Size and Location Drawing was not necessary, nor was scour analysis or in-depth hydraulic analysis.Our Hydraulic Analysis included extending or replacing a culvert only,which has very different calculation requirements than a structure.A slab bridge will require the use of HEC-RAS rather than HY-8 (this could be used for both extending and replacing the culvert). There is little information required for the HY-8 analysis; HEC-RAS analysis requires stream cross sections, nearby culvert information as well as scour analysis. An Abbreviated Bridge Condition Report(BCR)is not required. Some effort was expended evaluating the culvert extension option, which has now been eliminated. Preliminary Bridge Design and Hydraulic Report (PBDHR) — A PBDHR will be completed for the stream crossing. This contains the necessary information for use by IDOT District 1 and Bureau of Bridges and Structures to review the preliminary bridge design and hydraulics for local agency projects and for obtaining floodway permits from the IDNR Office of Water Resources(OWR). 6 The original hydraulic field visit for this project did not include the upstream and downstream crossings. A visit to obtain data regarding these culverts is now necessary. The PBDHR will include the following: Form BLR 10210 A Type,Size and Location Drawing will be included—NEW A Scour Critical Evaluation Coding Report Form will be completed—NEW Scour analysis data will be included with the PBDHR—NEW The Structure Geotechnical Report(SGR) will be included—this is in the original scope of work A Roadway Plan and Profile sheet will be included—this is in the original scope of work The Asbestos Determination Certification form(BLR 10220)will be included—NEW The updated Bulletin 70 will be used Location Drainage Study—A Location Drainage Tech Memorandum will be prepared to document, summarize, and report on the modeling, analysis, results, and proposed drainage improvements. Per the March 6, 2018 email,a full LDS will be prepared. Preliminary Drainage Design—We will prepare preliminary drainage plans to be included with the Location Drainage Tech Memorandum. Crash Analysis&Design Traffic Data Crash Analysis—Crash data for the intersections of Ridgeview Drive and IL Route 31 with Bull Valley Road for the 7 last 5-years will be analyzed for any pedestrian and bicycle crash patterns. Design Traffic Data—We will request bicycle volumes on the Prairie Trail from the MCCD, as well as any information that McHenry County Division of Transportation has for the path segment east of the project limits. The information available will be used to determine proposed user volumes on this segment of the path. Develop and Evaluate Design Alternatives Design Alternatives—We will prepare the preliminary design of the Bull Valley Road bicycle path, profile, and cross 8 sections. Several alternatives will be investigated and presented to the City for feedback. Our initial proposed design will be on the north side of Bull Valley Road to connect to the existing paths on either end of the project. If a cursory review of the north side of the road reveals significant concerns, an alignment on the south side of the road will be evaluated. We propose designing 3 separate alignments for the City to review. All proposed alignments will keep the multi-use path adjacent to the culvert, ensuring a separate structure is not necessary. The final design will be shown Bull Valley Road Bike Path - Phase I Engineering - February 2020 on plan and profile exhibits in the Project Development Report(PDR). Our team will prepare an engineering opinion of probable costs for the construction of each investigated improvement. Design Revision - The design of the shared use path on the north side of Bull Valley Road between the UP RR/Prairie Trail and IL 31 will be revised to accommodate a future 5-lane cross section on Bull Valley Road at the UP Railroad crossing and at the stream. The 5-lane section will have five 11-foot wide lanes with B-6.24 CC&G on the outside edges of pavement. The existing horizontal alignment of Bull Valley Road will be maintained, the proposed widening will be centered on the existing road. The plan/profile, typical sections, and cross section sheets will be revised to show this new design. The alternatives memorandum will be updated to include this new alignment. Preliminary Design -Crossing Preliminary Design —The culvert under Bull Valley Road to the east of Ridgeview Drive was recently constructed, meaning it is likely still in good condition.We propose to first evaluate extending the existing culvert both hydraulically and structurally to determine a cost for this improvement. Generally, the cost of replacing the culvert, if extending it causes hydraulic concerns, is significantly less than installing a separate structure.We propose keeping the path near the roadway in the vicinity of the culvert for all alignments, so the culvert can be extended.We d^ not feel separate structure will he g able option so them ed fora type c nd location drawing a art of this n ert 9 ADA Analysis—There are existing multi-use paths to the east and west along the north side of Bull Valley Road as well as near Ridgeview Drive. For continuity,the initial multi-use path designs will be on the north side of the roadway. Potential impacts will be evaluated,and if necessary,an alternate design on the south side of the street will be analyzed. The signalized crossings at Ridgeview Drive and IL Route 31 appear to meet current ADA guidelines. The remainder of the proposed path will also be designed to meet current guidelines. The intersection of Ridgeview Drive does not meet current guidelines according to recent survey. IL Route 31 is not MCDOT jurisdiction and has not been evaluated.A note will be added to the PDR indicating the intersections that are non-compliant and will need to be designed in Phase II. Scott Rodseth, our Construction Manager, has overseen 1,000 ramp installations and will perform QC/QA on the proposed ramp and multi-use path designs to ensure they are constructed in compliance with accessibility regulations. Project Development Report Project Development Report (PDR) — We will prepare a PDR summarizing our analyses, findings, and recommendations for the proposed improvements. As the PDR is developed, we will coordinate review of this document with the City. Once City staff approves the draft document,we will submit to IDOT for review. Upon receipt of review comments,we will make necessary updates and resubmit to IDOT for Design Approval. Maintenance of Traffic(MOT)Plan—We will complete a cursory analysis of Bull Valley Road for traffic management 10 during construction. Maintaining access to the businesses along Bull Valley Road is vital to the success of the project and will be kept at the forefront for all staging. It is not anticipated that construction of the path will significantly impact traffic. Submittals—We will make the following submittals to the City and IDOT: Preliminary(50%): City review Pre-final(90%): City and IDOT review Final(100%): City and IDOT submittal 111 Assistance with Grant Applications Grant Applications—We will assist the City with preparation of grant applications to secure funding for the project construction.We have a successful history of assisting municipalities with obtaining funding for projects. Bull Valley Road Bike Path - Phase I Engineering- February 2020 Agency Coordination Local Agency and Utility Coordination—Because we are a local firm,we can respond to your questions/concerns and routinely attend impromptu meetings with short notice. Our team will coordinate project activities with the City on an ongoing basis via phone, email, and personal meetings. Meeting minutes will be prepared for approval. We also anticipate an FHWA coordination meeting at IDOT to obtain concurrence for Federal Approved Categorical Exclusion processing and any possible design exceptions that may be needed. 1 2 Though the project is being led by the City, ongoing coordination with the McHenry County Division of Transportation and McHenry County Conservation District will ensure both organizations can provide input on the selection of the preferred alignment. Illinois Commerce Commission (ICC) & UP Railroad / Metra —Coordination with the ICC and UPRR/ Metra will need to be started early in the Phase I process to maintain the desired project schedule.Typically,the railroads require notification of the project and will meet to discuss the proposed crossing in Phase II, when full construction plans are available for review.A new crossing may require an ICC hearing. Public Involvement We will coordinate with affected property owners. Conceptual plans that show the proposed improvements and their impacts to the property will be sent out to get the property owner's input.We can also offer one-on-one meetings with those affected to discuss the proposed improvements and answer any questions they may have. Public Involvement—We will prepare for and attend a public/stakeholder meeting and a public hearing to provide details about the proposed improvement to area residents and businesses. We will prepare post cards and advertise in the newspaper to invite the public to the meeting. Exhibits will be provided during the meeting will include: Aerial strip maps 13 Project location maps Existing and proposed cross section exhibits Crash exhibits Right-of-way acquisition (if required) Bike and pedestrian exhibits Comments from the meeting will be compiled, summarized, and distributed to all participants as a newsletter or response letter. One public information meeting is adequate for the scope of this project.We feel the alignment selection will be driven by the locations of the existing multi-use paths.We can also hold individual meetings with affected property owners to discuss their concerns if necessary. It is assumed that the City will submit the newspaper advertisements to a local newspaper. Meetings We will prepare for, attend and write meeting minutes for the following anticipated meetings: Project kick-off meeting with City IDOT Phase I kick-off meeting 14 FHWA/IDOT Coordination meeting Progress meeting with the City Meeting with ICC and UPRR/Metra MCCD coordination meeting Additional coordination/conference calls(4 additional) Bull Valley Road Bike Path - Phase I Engineering- February 2020 Project Administration Project management and administration will last throughout the expected 14-month duration of the work order. Management and administration are necessary to ensure the successful completion of the project. The expected activities within this task include: 15 Project schedule/progress monitoring Staffing, monitoring, including allocating staff, as needed Budget monitoring Document management Staff coordination Invoicing Illinois Department Bridges And Culverts Hydraulic Report of Transportation Estimate Worksheet Project: Bull Valley Bike Path - Phase I Project No.: Name of Stream: Unnamed stream tributary to Fox River Structure No.: Structure Type: CMP Culvert Approximate Size: 2-49"(w)x33"(h)Pipe Arches Item Work Hours Hydraulic Stream Survey In Mai Or d Work der Without Boat With Boat Correlation with FIS Bench Marks Field Review by Hydraulic Engineer to inspect Study Area 8 Survey Note Conversion and Plotting (including cross-sections, stream profiles, and structures) In Main Work Order WIT(including supporting calculations, tables and summary data) 16 Hydraulic Report Data Sheets (including photos and required exhibits other than survey note 24 plotting) Hydrologic Model (independent analysis) based on StreamStats (modified) 12 Calibration of Hydrologic Model based on n/a 0 Hydraulic Model (independent analysis) HEC-RAS 40 Hydraulic Model n/a 0 regulatory analysis- Flood Insurance Study) Compensatory Storage Determination (including floodway permit forms, calculations, exhibits, 24 (No compensatory storage site plan, & proposed right-of-way) McHenry P&D) Scour Analysis (including field observation and scour depth calculation) 30 Narrative 24 QA/QC In Main Work Order Administrative In Main Work Order Report Assembly 16 TOTAL ESTIMATED WORK HOURS 194 Printed 7/25/2019 D1 PD0014(Rev. 11/03/14) 04 ' pr.U soSo2u77sZ2Y7.U ia o°o I $ #.al o + a 1 r N1. c.o ni • Ili JeCa I O O O y N N ti lvie.: iDin ir it l r I ` A v ' I O 10 1/ d 1 cn IO2 c oo . i cm In _ 0 Tee 0 B` IMMO 1. i wvp m d tX CO 4- S. O• C L r O C p U c4 A I a o U CD OO J to b I vo Phase I Engineering Bull Valley Road Multi-Use Path McHenry,IL Local Agency City of McHenry Firm's approved rates on file with IDOT's Bureau of Accounting and Auditing: Overhead Rate(OH) 159.00 % Complexity Factor(R)0.000 Method of Compensation: Calendar Days 450 Cost Plus Fixed Fee 1 ® 14.5%[DL+R(DL)+OH(DL)+IHDC] Cost Plus Fixed Fee 2 O 14.5%[DL+R(DL)+1.4(DL)+IHDC] Cost Plus Fixed Fee 3 O 14.5%[(2.3+R)DL+IHDC] Date: 2/19/2018 Specified Rate 0 (0.37+R)DL Lump Sum 0 Cost Estimate of Consultant's Services in Dollars In-House Man- Payroll Payroll Costs Overhead Services by Direct Element of Work Employee Classification Fixed Fee Total Hours Rate DL)DLxOH) Others Costs IHDC) 2 Field and Topographic Survey 0.00 0.00 Survey 2 36.0 _ $40.33 $1,451.88 $2,308.49 545.25 $4,305.62 Survey 1 36.0 30.88 $1,111.68 $1,767.57 417.49 $3,296.74 6 Drainage Studies 0.00 0.00 Engineer4 101.0 $45.32 $4,577.32 $7,277.94 1,719.01 $13,574.27 Engineer 3 90.0 40.38 $3,634.20 $5,778.38 1,364.82 $10,777.40 Structural Engineer 2 14.0 59.67 $835.38 $1,328.25, 313.73 $2,477.36 Structural Engineer 1 16.0 43.00 $688.00 $1,093.92 258.38 $2,040.30 Technician 1 50.0 23.58 $1,179.00 $1,874.61 442.77 $3,496.38 9 Preliminary Design 0.00 0.00 Engineer 6 4.0 53.00 $212.00 $337.08 79.62 $628.70 Engineer 4 12.0 45.32 $543.84 $864.71 204.24 $1,612.79 Engineer 3 8.0 40.38 $323.04 $513.63 121.32 $957.99 Engineer 2 24.0 35.20 $844.80 $1,343.23 317.26 $2,505.29 14/15 Meetings and Project Administration 0.00 0.00 Engineer6 12.0 53.00 $636.00 $1,011.24 238.85 $1,886.09 Engineer4 8.0 45.32 $362.56 $576.47 136.16 $1,075.19 Totals 411.0 16,399.70 $ 26,075.52 $6,158.90 $ 48,634.12 EXHIBIT A Printed on 2/12/20203:33 PM 1 of 2 Exh A-CPFF Route Bull Valley Road WORK HOUR ESTIMATE FOR CONSULTING SERVICES Local Agency City of McHenry Phase I Engineering Section Bull Valley Road Multi-Use Path Description Engineer 6 Engineer 4 Engineer 3 Engineer 2 Structural Structural Technician 1 Survey2 Survey1 In House Direct p g g g g Engineer 2 Engineer 1 Costs Adjusted Average Hourly Rates $53.00 $45.32 $40.38 $35.20 $59.67 $43.00 $23.58 $40.33 $30.88 2 Field and Topographic Survey 2.2alStream survey-includes 1st upstream and downstream crossings 36 36 SUB-TOTAL 72.0 36.0 36.0 $ PERCENT 50%50% 6 Drainage Studies 6.1a Field Visit to evaluate upstream and downstream crossings 5 6.4 Prel.Bridge Design and Hydraulic Report(PBDHR) 20 6.4a Hydraulic Report 96 70 6.4b Type,Size and Location Drawing 14 16 50 SUB-TOTAL 271.0 101.0 90.0' 14.0 16.0 50.0 PERCENT 37%33% 5% 6%18% 9 Preliminary Design 9.1 alAlignment alternatives-revised design for 5-lane at RR and culvert 4 12 8 24 SUB-TOTAL 48.0 4.0 12.0 8.0 24.0 PERCENT 8%25%17%50% 14/11Meetings and Project Administration 14.7 Coordination meetings/conference calls(assume 4 additional) 4 8 15.0 Project Administration 8 SUB-TOTAL 20.0 12.0 8.0 PERCENT 60%40% TOTALS 411.0 16.0 121.0 98.0 24.0 14.0 16.0 50.0 36.0 36.0 PERCENT 4%29%24% 6% 3% 4%12% 9% 9% EXHIBIT A Printed on 2/12/20203:33 PM 2 of 2 Hours by Task Local Agency City of McHenry Bull Valley Road Multi-Use Path City of McHenry Phase I Engineering Development of Project Hourly Rates (IDOT Method) 2019 2020 2021 2022 2023 Item 2018 Projected Projected Projected Projected Projected Actual Rate @ 3.0% @ 3.0% @ 3.0% @ 3.0% @ 3.0% Increase Increase Increase Increase Increase Average Hourly Rate as a 100.0% 100.0% 106.1% 109.3% 112.6% 115.9% Percent of 2017 Rate Estimated Months of Contract in 8 4 0 0 0 0 Given Year of Project Duration 66.67% 33.33%0.00%0.00%0.00%0.00% Extension 0.667 0.333 0.000 0.000 0.000 0.000 Weighted Project Hourly Rate Note: Salary Adjustments are applied on January 1 of Each 1.0000 Multiplier Year Project Duration: 12 months Allowed Percentage Escalation 3.00% 1.030 EXHIBIT A Printed on 7/25/201910:14 AM 3 of 4 Escalator Avg. Hly.Calc. Local Agency City of McHenry Bull Valley Road Multi-Use Path City of McHenry Phase I Engineering Escalation Factor 1.000 Classification 2018 Actual Rate Adjusted Rate Principal 69.00 $ 69.00 Engineer 6 53.00 $ 53.00 Engineer 5 50.17 $ 50.17 Engineer 4 45.32 $ 45.32 Engineer 3 40.38 $ 40.38 Engineer 2 35.20 $ 35.20 Engineer 1 27.50 $ 27.50 Structural Engineer 2 59.67 $ 59.67 Structural Engineer 1 43.00 $ 43.00 Technician 3 39.25 $ 39.25 Technician 2 30.12 $ 30.12 Technician 1 23.58 $ 23.58 Intern/Temporary 18.00 $ 18.00 Land Acqusition 39.67 $ 39.67 Survey 2 40.33 $ 40.33 Survey 1 30.88 $ 30.88 Environmental 2 43.00 $ 43.00 Environmental 1 22.15 $ 22.15 Administrative 2 39.73 $ 39.73 Administrative 1 19.88 $ 19.88 EXHIBIT A Printed on 7/25/201910:14 AM 4 of 4 Avg. Hly. Rates Bill Hobson, Director of Parks and Recreation McHenry Recreation Center 3636 Municipal Drive McHenry, Illinois 60050 McHenry Phone: (815) 363-2160 Fax: (815) 363-3119 www.cityofmchenry.org/park_recreation CONSENT AGENDA SUPPLEMENT DATE: September 8, 2020 TO: Mayor and City Council FROM: Bill Hobson, Director of Parks and Recreation RE: McHenry Parks & Recreation Facilities &Special Use permit requests ATT: Permit List and Applications All fees and documentation have been satisfactorily submitted for the attached McHenry Parks Recreation Facilities &Special Use permit requests. If Council concurs, then it is recommended a motion is considered to approve the attached McHenry Parks & Recreation Facilities & Special Use permit requests. The City of McHenry is dedicated to providing its citizens,businesses,and visitors with the highest quality ofprograms and services in a customer-oriented,efficient,and fiscally responsible manner. FOR COUNCIL MEETING ON SEPTEMBER 8, 2020 Shelter Rental Alcohol Permits These are alcohol permit requests associated with shelter rentals Date Applicant Address Park Purpose 09-12-20 Mikaila Connor 4708 Argyle Lane PP A Birthday Party 09-17-20 Sue Miller 4203 South Street Vets Realtor Picnic 09-19-20 Amy Devine 5301 Shore Drive Vets Graduation Party Special Use Permits These are special use permit requests associated with shelter rentals Date Applicant Address Park Special Use 09-19-20 S. DiRubbo/RC Club 5104 Sandburg Drive PP Beach R/C Seaplane Fly-In 09-26-20 K. Adams/Amer Legion 1331 N. Riverside Drive Vets Anniversary/Performers Recreation Center Room Rental Alcohol Permits These are alcohol permit requests associated with Recreation Center room rentals or programs. Date Applicant Address Rec Center Purpose None 1 ed. McHenry Recreation Centerad Facilit Application McHenry y Rental & Special Use Permit Application Date:) Rental Date: 9' 01/4-az Rental Time(Include set-up/clean-up):m Name of Applicant: l'nY\Of Date of Birth: - Group/Organization(if applicable): 1 `Address: Event Title/Activity: a h C1 1 n In Attendance: c, SHELTER/SAFETY TOWN:(daily rate) 0 Knox A , sPetersen A Petersen c 0 Safety Town Knox B Petersen B 0 Veterans Other WEDDING: Rails removed at Veterans Memorial Park($25 fee) MCHENRY RECREATION CENTER:(hourly rate) ROOM: Kitchen iS3s tee)Room A Room B Room C Studio SET-UP: 0 Banquet Board Room 0 Classroom 0 Theater TABLES/CHAIRS: #Round f!Rect ii Chairs BEER/WINE:(at least 4 weeks notice needed)—No other alcohol allowed TYPE: 0 Wine Beer // AMOUNT: Ii Bottles Ii Cases a SPECIAL USE:(at least 4 weeks notice needed)—Equipment provided by renter Tent Location: Bounce House*Applicant to call JULIE(1-800-892-0123)for staking of Tents/Bounce Houses if Tables El Band/D1 0 Carnival Rides 0 Animals 0 II Chairs 0 Wedding Arch 0 Performer 0 Catered Pig Roast o 01' Date Approved: OTHER: Grou Copy to Maintenance:_ DAMAGE DEP: Credi Card Sent: Signa Approval will be based on the Items listed above.Any other requests are subject to further approval.If applicable,health permits are requiredbylawforconcessionsandcatering.Please make arrangements to obtain permits.McHenry County Department of Health:81S-334.4585Iagreeallalcoholcontainerswillberemovedbyapplicantorplacedinpropercontainersonsiteontherentaldateandthatno underage orintoxicatedpersonwillbeallowedtoconsumeanyalcoholbroughtintoCityofMcHenrypropertyunderthispermit.I agree that none of the alcoholallowedInCityofMcHenryproperty,pursuant to this application will be sold,It being understood that the sale of alcohol under this permit Issuedpursuanttothisapplicationisexpresslyprohibited.I also understand that not complying with the rules will result In loss of deposit.I agree to hold the City of McHenry,Its employees and agents harmless,and Indemnify same from any and all liability of Injury to person orpropertyoccurringasaresultoftheactivitysponsoredbypermitteeandsaidpersonshallbeliabletotheCityofMcHenryforanyandalldamagetoparks,recreation facilities and equipment owned by same,which results from or during the activity of permittee or Is caused by participant In said activity.AllpersonsagreetocomplywiththeCityofMcHenryMunicipalCodeandallParks&Recreation regulations.I have read and fully understand the McHenry Recreation Center Rental and/or Shelter Guldellnes. McHenry Recreation Center Facility Rental & Special Use Permit Application McHenryPattitrItxraLL+,lkN+rnvnr -,at 8/25/2020ApplicationDate: Rental Date:9/17/2020 Rental Time(include set-up/clean-up): 2pm-8pm Name of Applicant:Sue Miller Date of Birth: Group/Organization(if applicable): Sue Miller, REACTOR Address:4203 South ST city/state/zip:McHenry, IL 60050 Home Phone: Personal Email:smiller001@aol.com Event Title/Activity:Sue Miller, Realtor PicNic Attendance:50 SHELTER/SAFETY TOWN:(daily rate) Knox A Petersen A 0 Petersen C Safety Town Knox B Petersen B N Veterans 0 Other WEDDING: Rails removed at Veterans Memorial Park($25 fee) MCHENRY RECREATION CENTER:(hourly rate) ROOM: 0 Kitchen($35 fee) 0 Room A 0 Room B Room C 0 Studio SET-UP: 0 Banquet 0 Board Room Classroom Theater TABLES/CHAIRS: it Round Rect Chairs BEER/WINE:(at least 4 weeks notice needed)—No other alcohol allowed TYPE: 0 Wine 0 Beer AMOUNT:Bottles 10 it Cases 5 SPECIAL USE:(at least 4 weeks notice needed)—Equipment provided by renter Tent Location: Bounce House *Applicant to call JULIE(1-800-892-0123)for staking of Tents/Bounce Houses it Tables 0 Band/DJ 0 Carnival Rides Animals Chairs 0 Wedding Arch x Performer 0 Catered Pig Roast Othe Date Approved: l OTHER: Groups Copy to Maintenance: b/ 2Zla Z DAMAGE DEP: Credit( Card Sent: Signatu Approval will be based on the items listed above.Any other requests are subject to further approval.If applicable,health permits are required by law for concessions and catering.Please make arrangements to obtain permits.McHenry County Department of Health:815-334-4585 I agree all alcohol containers will be removed by applicant or placed in proper containers on site on the rental date and that no underage or Intoxicated person will be allowed to consume any alcohol brought into City of McHenry property under this permit.I agree that none of the alcohol allowed in City of McHenry property,pursuant to this application will be sold,it being understood that the sale of alcohol under this permit issued pursuant to this application is expressly prohibited.I also understand that not complying with the rules will result in loss of deposit. I agree to hold the City of McHenry,its employees and agents harmless,and indemnify same from any and all liability of injury to person or property occurring as a result of the activity sponsored by permittee and said person shall be liable to the City of McHenry for any and all damage to parks, recreation facilities and equipment owned by same,which results from or during the activity of permittee or is caused by participant in said activity.All persons agree to comply with the City of McHenry Municipal Code and all Parks&Recreation regulations.I have read and fully understand the McHenry Recreation Center Rental and/or Shelter Guidelines. Signature: S Nei', Date:8/25/2020 McHenry Recreation Center Facility Rental & Special Use Permit Application McHenryPol,&R,rflflh lkNnmrnl "Y ' Om AM, Application Date: lS /"'/. 2O Rental Date: (?/, IT ,-) 0 Rental Time(include set-up/clean-up): Name of Applicant: 1 { / a-e{)/l p Date of Birth: Group/Organization(if applicable): Address: D 30/ cS/IY e (Or, City/State/Zip: / !(//f'/'jr Event Title/Activity: /771jf j sc./i 'r / J'/Q' i Lt hziIF/ n(2A"/7/ Attendance: - 1) SHELTER/SAFETY TOWN:(daily rate) J Knox A 0 Petersen A Petersen C Safety Town Knox B 0 Petersen B Veterans Other WEDDING: 0 Rails removed at Veterans Memorial Park($25 fee) MCHENRY RECREATION CENTER:(hourly rate) ROOM: Kitchen($35 fee) Room A Room B Room C Studio SET-UP: 0 Banquet Board Room Classroom Theater TABLES/CHAIRS: #Round if Rect Chairs BEER/WINE:(at least 4 weeks notice needed)—No other alcohol allowed TYPE: 0 Wine b Beer AMOUNT:Bottles H Cases ' / SPECIAL USE:(at least 4 weeks notice needed)—Equipment provided by renter 0 Tent Location: 0 Bounce House *Applicant to call JULIE(1-800-892-0123)for staking of Tents/Bounce Houses 1#Tables) -j Band/DJ 0 Carnival Rides Animals (.440 l //t'Y ziQ"I; Chairs 0 Wedding Arch 0 Performer Catered Pig Roast Other Date Approved: OTHER: Groups ov Copy to Maintenance: )9 VA/7:3 DAMAGE DEP: Credit Can Card Sent: Signature: Approval will be based on the items listed above.Any other requests are subject to further approval.If applicable,health permits are required by law for concessions and catering.Please make arrangements to obtain permits.McHenry County Department of Health:81S-334-4585 i agree ail alcohol containers will be removed by applicant or placed in proper containers on site on the rental date and that no underage or intoxicated person will be allowed to consume any alcohol brought into City of McHenry property under this permit.I agree that none of the alcohol allowed in City of McHenry property,pursuant to this application will be sold,it being understood that the sale of alcohol under this permit issued pursuant to this application is expressly prohibited.I also understand that not complying with the rules will result in loss of deposit. I agree to hold the City of McHenry,its employees and agents harmless,and indemnify same from any and all liabi:ity of injury to person or property occurring as a result of the activity sponsored by permittee and said person shall be liable to the City of McHenry for any and all damage to parks, recreation facilities and equipment owned by same,which results from or during the activity of permittee or is caused by participant In said activity.All persons agree to comply with the City of McHenry Municipal Code and all Parks&Recreation regulations.I have read and fully understand the McHenry Recreation Center Renta and/or Shelterlt Guidelines. N Signature: C /c 1-U_,V/z'l)Date: ( //y/ T o McHenry Recreation Center Facility Rental & Special Use Permit Application McHenry ppfmL6R. Ii,l„,...., 0O/18/20ApplicationDate: September 19, 2020 Rental Time include set u clean u 8:30 am -4:30 pm Rental Date: I/p): Name of Applicant:Salvatore DiRubbo Date of Birth: Group/Organization(if applicable): Chain -0- Lakes RIC Club Address:5104 Sandburg Dr. city/state/zip:McHenry, IL 60050 Home Phone: R/C Model Seaplane Fly-in 50 (less than) Event Title/Activity: p y Attendance: SHELTER/SAFETY TOWN:Wally rate) Knox A 0 Petersen A 0 Petersen C 0 Safety Town ElKnox B 0 Petersen B 0 Veterans 0OtherPetersen Beach WEDDING: 0 Rails removed at Veterans Memorial Park($25 fee) MCHENRY RECREATION CENTER: (hourly rate) ROOM: 0 Kitchen(535 feel Room A 0 Room B 0 Room C 0 Studio SET-UP: 0 Banquet 0 Board Room 0 Classroom 0 Theater TABLES/CHAIRS: It Round it Rect Chairs BEER/WINE:(at least 4 weeks notice needed)-No other alcohol allowed TYPE: 0 Wine 0 Beer AMOUNT:It Bottles Cases SPECIAL USE:(at least 4 weeks notice needed)-Equipment provided by renter Tent LorAtizar t--/C M xik-- S cz ti f\.e,..An e Bounce House *Applicant to call JULIE(1-800-892-0123)for staking of Tents/Bounce Houses Tables 0 Band/DJ 0 Carnival Rides 0 Animals Chairs 0 Wedding Arch 0 Performer 0 Catered Pig Roast Other_ Date Approved: OTHER: Groups ov Copy to Maintenance: f 1(p j 2.o DAMAGE DEP: Credit Car Card Sent: Signature: Approval will be based on the items listed above.Any other requests are subject to further approval.If applicable,health permits are required by law for concessions and catering.Please make arrangements to obtain permits.McHenry County Department of Health:815-334-4585 I agree all alcohol containers will be removed by applicant or placed in proper containers on site on the rental date and that no underage or intoxicated person will be allowed to consume any alcohol brought into City of McHenry property under this permit.I agree that none of the alcohol allowed in City of McHenry property,pursuant to this application will be sold,It being understood that the sale of alcohol under this permit Issued pursuant to this application is expressly prohibited.I also understand that not complying with the rules will result in loss of deposit. I agree to hold the City of McHenry,its employees and agents harmless,and indemnify same from any and all liability of injury to person or property occurring as a result of the activity sponsored by permittee and said person shall be liable to the City of McHenry for any and all damage to parks, recreation facilities and equipment owned by same,which results from or during the activity of permittee or is caused by participant in said activity.All persons agree to comply with the City of McHenry Municipal Code and all Parks&Recreation regulations.I have read and fully understand the McHenry Recreation Center Rental n r Si elter Gui Ines. Signature: t G .T t Date:08/18/20 McHenry Recreation Center Facility Rental & Special Use Permit Application McHenryPori,6 RnIN!: I\r.nrvnr -] Application Date:8-18-2020 Rental Date:9-26-2020 Rental Time(include set-up/clean-up).. 10:00-6:00 Name of Applicant:Kevin Adams Date of Birth: Group/Organization(if applicable):American Legion Post 491 Address:1331 N. Riverside Dr. Event Title/nctivity:100th year Anniversary Attendance:50 SHELTER/SAFETY TOWN:(daily rate) 0 Knox A 0 Petersen A Petersen C 0 Safety Town Knox B 0 Petersen B 18 Veterans 0 Other WEDDING: Rails removed at Veterans Memorial Park($25 fee) MCI IENRY RECREATION CENTER:(hourly rate) ROOM: Kitchen(sss fee)O Room A 0 Room B Cl Room C Studio SET-UP: Banquet U Board Room 0 Classroom L7 Theater TABLES/CHAIRS: fi Round ft Rect_ It Chairs BEER/WINE:(at least 4 weeks notice needed)-No other alcohol allowed TYPE: 0 Wine 0 Beer AMOUNT: N Bottles Cases SPECIAL USE:(at least 4 weeks notice needed)-Equipment provided by renter Tent Location: 0 Bounce House *Applicant to call JULIE(1-800-892-0123)for staking of Tents/Bounce Houses H Tables_ Band/DJ 0 Carnival Rides Animals tt Chairs 0 Wedding Arch 0 Performer 0•Catered Pig Roast 0 Other esAA/Lk OTI IER: Groups over 500 must obtain: O Durnpsters Portable Toilets DAMAGE DEP: Credit Card Nub r: Expiration: CW: Signature: , ./f/ "f /Date: 0/ I(1 L Approval will be based on the items listed above.Any other requests are subject to further approval.If applicable,health permits are required by law for concessions and catering.Please make arrangements to obtain permits.McHenry County Department of Health:815334-4585 I agree all alcohol containers will be removed by applicant or placed In proper containers on site on the rental date and that no underage or Intoxicated person will be allowed to consume any alcohol brought into City of McHenry property under this permit.I agree that none of the alcohol allowed in City of McHenry property,pursuant to this application will be sold,it being understood that the sale of alcohol under this permit issued pursuant to this application is expressly prohibited.I also understand that not complying with the rules will result In loss of deposit. 1 agree to hold the City of McHenry,its employees and agents harmless,and Indemnify same from any and ailliability of injury to person or property occurring as a result of the activity sponsored by permittee and said person shall be liable to the City of McHenry for any and all damage to parks, recreation facilities and equipment owned by same,which results from or during the activity of permittee or Is caused by participant in said activity.All persons agree to comply with the City of Mctlenry Municipal Code and all Parks&Recreation regulations.I have read and fully understand the McHenry Recreation Center Renta /or Shelte Guidelines. AarSignature: 7/4 Date: () ./C) l_0.) City of McHenry Council Meeting Minutes 8.17.20 McHenr MINUTES REGULAR CITY COUNCIL MEETING Monday, August 17, 2020, 7:00 p.m. In light of the current COVID-19 public health emergency, this meeting will be held remotely only. The public can observe by connecting online at: https://cityofmchenry.zoom.us/j/93854825282. The public can also call in to the following number: 1 312 626 6799, Meeting ID 938 5482 5282. Call to Order: : The City Council of the City of McHenry, Illinois, met in regular session on Monday, August 17, 2020, at 7:00 p.m. via Zoom due to the COVID-19 pandemic in compliance with the Open Meetings Act per guidelines by the Illinois Attorney General's office. Roll Call: Mayor Jett called the roll call. Members present: Alderman Santi, Alderman Glab, Alderman Schaefer, Alderman Harding- absent, Alderman Mihevc, Alderman Devine, Alderwoman Miller, and Mayor Jett. Others present: Attorney McArdle, Administrator Morefield, Interim Director of Public Works Strange, Director of Community Development Polerecky, Finance Director Lynch, Director of Parks and Recreation Hobson, Director of Economic Development Martin, Chief of Police Birk,City Planner Sheriff, and City Clerk Ramel. Pledge of Allegiance: Mayor Jett led the pledge Public Comments: None Consent Agenda: Motion to Approve the Following Consent Agenda Items: A. Accept the proposal from Advanced Automation and Controls of McHenry, IL in an amount not to exceed $20,365.00 to replace the Water Division SCADA server and upgrade the operating software; (Public Works Director Strange) B. Block Party Permit Application for Jennifer Lane on 8/22/20; C. August 3, 2020, City Council Meeting Minutes; D. Issuance of Checks in the amount of$224,327.82; E. Issuance of As Needed Checks in the amount of $292,196.69. A motion was made by Alderman Schaefer and seconded by Alderwoman Miller to approve Consent Agenda Items as presented: Roll Call: Vote: 7-ayes: Alderman Santi, Alderman Glab, Alderman Schaefer, Alderman Harding, Alderman Mihevc, Alderman Devine, Alderwoman Miller. 0-nays, 0-abstained. Motion carried. Individual Action Item Agenda 1 City of McHenry Council Meeting Minutes 8.3.20 A. Motion to pass an Ordinance approving text amendments to Chapter 13: Fences of the City of McHenry Municipal Code. (Community Development Director Polerecky) As explained by Director of Community Development Polerecky. Alderman Glab asked if fences are part of the zoning ordinance, they are actually part of the building code per Attorney McArdle. Confirmation by Director of Community Development Polorecky, these are all under the municipal code. Building set backs are different than fences per Attorney McArdle. Some conversation went on regarding this topic per Alderman Glab, not favorable of this ordinance. Alderwoman Miller clarified how she interpreted this ordinance felt it was streamlining processes. Many communities around us have this kind of ordinance to help streamline the processes. No public comments A motion was made by Alderwoman Miller and seconded by Alderman Santi to approve Individual Agenda items as presented. Roll Call: Vote: 6-ayes: Alderman Santi, Alderman Schaefer, Alderman Harding, Alderman Mihevc, Alderman Devine, Alderwoman Miller. 1-nays- Alderman Glab, 0-abstained. Motion carried. B. Motion to approve the continuation of the local disaster emergency for the City of McHenry pursuant to Section 6-1-14, Declaration of Local Emergency, of the Municipal Code to September 21, 2020 (City Attorney McArdle) Attorney McArdle stated that The City is getting closer to hear if there will be reimbursement by the state. A motion was made by Alderman Santi and seconded by Alderman Harding to approve Individual Agenda items as presented. Roll Call: Vote:7-ayes: Alderman Santi, Alderman Glab, Alderman Schaefer, Alderman Harding, Alderman Mihevc, Alderman Devine, Alderwoman Miller. 0-nays, 0-abstained. Motion carried. C. Motion to Adopt Proposed Resolution Authorizing a Binding Public Question to be placed on the November 3, 2020, General Election Ballot, on the Question of Appointing the McHenry City Clerk A motion was made by Alderman Santi and seconded by Alderman Schaefer to approve Individual Agenda items as presented. Roll Call: Vote:7-ayes: Alderman Santi, Alderman Glab, Alderman Schaefer, Alderman Harding, Alderman Mihevc, Alderman Devine, Alderwoman Miller. 0-nays, 0-abstained. Motion carried. Discussion Items: A. Discussion and direction regarding moving forward with facilitating an extension of the existing Downtown Tax Increment Finance (TIF) District. (Staff) This Discussion Item was presented by Director of Parks and Recreation Hobson via PowerPoint. The public improvements can utilizing this funding. Many of the projects were explained in the presentation and the future plans were also listed for The Council. Some improvements included; Streetscapes, Main Sewer Replacement, LED lighting, and Veterans Park improvements. Estimated performance of the TIF in the future was also explained to The Council, a chart was presented for those to view. There were some major sites presented 2 City of McHenry Council Meeting Minutes 8.3.20 where development is needed. Downtown maintenance costs were presented as one of the biggest issues that need upgrading. The extension process was also described to The Council. Administrator Morefield explained that there has been discussions with several of the taxing bodies. Alderman Glab wanted to know what the future plans are regarding some of these topics, wants to see focus on long range plans. Alderwoman Miller is in favor of this, likes the amount of future work of the redevelopment, she would like to see the extension of the TIF. Some discussion went on regarding this topic. Many spoke positive of the presentation and idea of support of the TIF extension. Mayor Jett spoke of the developers that are interested in the town, supports this as well. There will be an ordinance to actually vote on now that many are interested to extend the TIF, per Director Hobson, offered to give the presentation out to whom would like it and would be happy to answer any questions. B. Discussion regarding criteria and process for revision of McHenry Ward Map. (City Attorney McArdle) — No Supplement Provided Attorney McArdle asked if this is something that The Council would like to discuss. There was some discussion regarding rooftop numbers and how many numbers are in the ward. The census would come into play regarding the household numbers. Attorney McArdle stated that once the census comes out a committee could be formed to address these issues. Staff Reports: Administrator Morefield, reminded The Council that Tuesday September 8th is the next meeting, due to holiday. Budget wise he will brief The Council regarding that information, may be added as a discussion item. Super Aggregates sent an invitation to do tours on Aug 22 and Sept 12 for tours. Several council members were interested in attending. Monday 24th 6pm Public Works meeting was also brought up as a reminder by Director of Public Works Strange. Mayor's Report: Stop by to check out the paving and striping that Parks and Recreation did, commended the job of The Council on that project. City Council Comments: Alderman Schaefer stated that there was positive comments regarding the tree debris removal, much appreciated regarding this. Wanted to know if we could get counts on the gravel trucks, to Director Polerecky from Alderman Schaefer. He will reach out to see if we can get that information. Alderwoman Miller stated that the curb pick up has been positive in her ward, thankful for that. Executive Session: Not at this time. Adjourn: A motion was made Alderman Santi and seconded by Alderman Schaefer to adjourn the meeting at 8:35 PM. Roll Call: Vote:7-ayes: Alderman Santi, Alderman Glab, Alderman Schaefer, Alderman Harding-absent, Alderman Mihevc, Alderman Devine, Alderwoman Miller. 0-nay-, 0-abstained. Motion carried. 3 City of McHenry Council Meeting Minutes 8.3.20 X X Mayor Wayne Jett City Clerk Trisha Ramel 4 Expense Approval Register McHenry, IL List of Bills Council Meeting - 9-8-2020 MidnrY Vendor Name Payable Number Post Date Description (Item) Account Number Amount Vendor. AERAPY LLC AERAPY LLC 2007241 09/08/2020 721-132 100-01-8200 6,727.00 Vendor AERAPY LLC Total: 61727,00 Vendor: BARTULIS, DEVON BARTULIS, DEVON 273312 09/08/2020 3RD PLACE FINISH MENS WED 100-41-3637 50,00 Vendor BARTULIS, DEVON Total: 50,00 Vendor: BAXTER & WOODMAN BAXTER & WOODMAN 0215708 09/08/2020 OAKWOOD DR BRIDGE REHAB 270-00-8600 1,775.49 Vendor BAXTER & WOODMAN Total: 1,775.49 Vendor: DENSON ELECTRICAL CONTRACTING, INC BENSON ELECTRICAL 20-359 09/08/2020 POLICE RECEPTION ADMIN 100-01-8200 1,296.00 BENSON ELECTRICAL 20-389 09/08/2020 AIR PURIFIERS - DISPATCH 100-01-8200 1,945.00 Vendor BENSON ELECTRICAL CONTRACTING, INC Total: 3,241.00 Vendor: BROWN, BRAD BROWN, BRAD 8/21/2020 09/08/2020 VARIOUS PATCHES 10001-8200 500,00 Vendor BROWN, BRAD Total: 500,00 Vendor: CLEARVIEW LANDSCAPE CONSTRUCTION, INC CLEARVIEW LANDSCAPE 20203 09/08/2020 MOWING 6/22-8/14/20 100-33-5110 31962,40 CLEARVIEW LANDSCAPE 20203 09/08/2020 MOWING 6/22-8/14/20 100-45-5110 23,032,00 CLEARVIEW LANDSCAPE 20203A 09/08/2020 MOWING 6/22-8/14/2020 510-31-5110 1,424.00 CLEARVIEW LANDSCAPE 20203A 09/08/2020 MOWING 6/22-8/14/2020 510-32-5110 1,061.60 Vendor CLEARVIEW LANDSCAPE CONSTRUCTION, INC Total: 29,480.00 Vendor: CONDUENT HR CONSULTING LLC CONDUENT HR CONSULTING 24S1275 09/08/2020 JULY 2020 SERVICE FEES 600-00-6960 69,75 Vendor CONDUENT HR CONSULTING LLC Total: 69.75 Vendor: CONSTELLATION NEWENERGY INC CONSTELLATION NEWENERGY INV0010386 09/08/2020 UTIL 100-33-5520 18,73 CONSTELLATION NEWENERGY INV0010386 09/08/2020 UTIL 100-44-5510 25,52 Vendor CONSTELLATION NEWENERGY INC Total: 44,25 Vendor: CRESCENT ELECTRIC SUPPLY CO CRESCENT ELECTRIC SUPPLY CO 5508025215.012 09/O8/2020 Vendor: DAHLKE, GRANT DAHLKE, GRANT 8/14/2020 DAHLKE, GRANT 8/29/2020 Vendor: EBY GRAPHICS INC EBY GRAPHICS INC 6871 Vendor: FLEMING, CHRISSV FLEMING, CHRISSY 20-01-030 Vendor: FOX VALLEY FIRE & SAFETY FOX VALLEY FIRE & SAFETY IN00370841 Vendor: FREUND &SON INC, S H FREUND&SON INC,SH 8-15-20 PD RENOVATION S00-01-8200 742.19 Vendor CRESCENT ELECTRIC SUPPLY CO Total: 742,19 09/08/2020 MINI MMAC 100-42-5110 36.00 09/08/2020 MMAC STROKE B/19-8/26& 100-47-5110 132.00 Vendor DAHLKE, GRANTTotal: 168.00 09/08/2020 PD EQUIP 100-22-8300 317,44 Vendor EBY GRAPHICS INC Total: 317,44 09/08/2020 CXLON TEMP SIGN PERMIT 100-GO-3410 30.00 Vendor FLEMING, CHRISSYTotal: 30,00 09/08/2020 MON RADIO MAINT 225-00-5110 11371,50 Vendor FOX VALLEY FIRE & SAFETY Total: 1,371.50 09 t08/2020 PD BUILDOUT 100-01-8200 210687,00 Vendor FREUND & SON INC, S H Total: 21,687,00 9/2/2020 12:56:30 PM Expense Approval Register Packet: APPKT01908 - 9-1-20 AP CKS Vendor Name Payable Number Post Date Description (item) Account Number Amount Vendor: GLENVIEW POLICE PENSION FUND GLENVIEW POLICE PENSION INVO010388 09/08/2020 LAZICKI -TRANSFER OF 760-00-4990 234,629.26 Vendor GLENVIEW POLICE PENSION FUND Total: 234,629.26 Vendor: GORSKI, SHARON GORSKI, SHARON 273164 09/08/2020 HHOLD CR REFUND 100-41-3636 19,20 Vendor GORSKI, SHARON Total: 19.20 Vendor: HRGREEN HRGREEN 137111 09/08/2020 PREL ENG SVS PHASE I&2 270-00-8600 41274,00 HRGREEN 137185 09/08/2020 RET PERS CUNAT PATRIOT 740-00-5220 11897,50 HRGREEN 137186 09/08/2020 CUNATTOWNHOMESOF 740-00-5220 1,532.00 HRGREEN 137188 09/08/2020 MCHENRY 7-11 740-00-5220 185,00 Vendor HRGREEN Total: 70888,50 Vendor: ILLINOIS BONE AND JOINT ILLINOIS BONE ANDJOINT INVO010389 09/08/2020 KLECHAK IME INVOICE 760-00-5110 1,274.00 Vendor ILLINOIS BONE AND JOINT Total: 1,274.00 Vendor: IMPACT NETWORKING LLC IMPACT NETWORKING LLC IS872591 09/08/2020 COPY PAPER 100-01-6210 398.00 IMPACT NETWORKING LLC 15872591 09/08/2020 COPY PAPER 100-22-6210 252,00 IMPACT NETWORKING LLC 15872591 09/08/2020 COPY PAPER 100-41-6210 325.00 Vendor IMPACT NETWORKING LLCTotal: 975,00 Vendor: KORNFEIND, HALEY KORNFEIND, HALEY 8/31/2020 09/08/2020 8/19-8/26/20205OFTBALL 100-47-5110 86,25 Vendor KORNFEIND, HALEY Total: 86.25 Vendor: LAUTERBACH & AMEN, LLP LAUTERBACH&AMEN, LLP 48036 09/08/2020 APRIL 30,2020 GASB 67/68 760-00-5110 21450,00 Vendor LAUTERBACH & AMEN, LLP Total: 2,450.00 Vendor: LOBERMEIER, HENRY LOBERMEIER, HENRY 273310 09/08/2020 2ND PLACE, MENS WED MINI 100-41-3637 75,00 Vendor LOBERMEIER, HENRYTotal: 75,00 Vendor: MARSH USA INC MARSH USA INC 376333332259 09/08/2020 R LUMBER NOTARY BOND 100-22-5110 20.00 Vendor MARSH USA INC Total: 20,00 Vendor: MARTINEZ, GASPAR MARTINEZ, GASPAR P99134 09/08/2020 OVERPD PARKING TICKET 100-22-3510 25,00 Vendor MARTINEZ, GASPAR Total: 25,00 Vendor: MCANDREWS PC, THE LAW OFFICE OF PATRICK MCANDREWS PC, THE LAW INVO010390 09/08/2020 AUG TRAFFIC 100-01-5230 4,000.00 Vendor MCANDREWS PC, THE LAW OFFICE OF PATRICK Total: 4,000.00 Vendor: MCHENRY COUNTY RECORDER OF DEEDS MCHENRY COUNTY RECORDER 2020820-16 09/08/2020 4TH QUARTER 620-00-5110 275,00 Vendor MCHENRY COUNTY RECORDER OF DEEDS Total: 275.00 Vendor: MCHENRY SAVINGS BANK MCHENRY SAVINGS BANK 520733418/20/20 09/08/2020 REGULAR PAYMENT 200-00-7600 4,321.80 MCHENRY SAVINGS BANK 520733418/20/20 09/08/2020 REGULAR PAYMENT 200-00-7610 29,288,18 Vendor MCHENRY SAVINGS BANK Total: 33,60%98 Vendor: METROPOLITAN MAYORS CAUCUS METROPOLITAN MAYORS 2019-031 09/08/2020 2018-2019 MSHIP CAUCUS 100-01-5410 11214,64 Vendor METROPOLITAN MAYORS CAUCUS Total: 10214,64 Vendor: MULTISYSTEM MANAGEMENT COMPANY INC MULTISYSTEM MANAGEMENT 2320 09/08/2020 JULY 2020 JANITORIAL SVS 100-33-5115 250.00 Vendor MULTISYSTEM MANAGEMENT COMPANY INC Total: 250.00 Vendor: MUNICIPAL COLLECTION SERVICES INC MUNICIPAL COLLECTION 017076 09/08/2020 COLL-LOCAL ORD 100-04-5110 243,83 MUNICIPAL COLLECTION 017284 09/08/2020 COLLECTIONS 100-04-5110 321.33 MUNICIPAL COLLECTION 017285 09/08/2020 COLLECTIONS 100-04-5110 363.45 9/2/2020 12:56:30 PM Expense Approval Register Packet: APPKT01908 - 9-1-20 AP CKS Vendor Name Payable Number Post Date Description (Item) Account Number Amount MUNICIPAL COLLECTION 0717077 09/08/2020 COLLECTIONS -PD 100-04-5110 326,38 Vendor MUNICIPAL COLLECTION SERVICES INC Total: 11254,99 Vendor: OTTOSEN DINOLFO HASENBALG & CASTALDO, LTD OTTOSEN DINOLFO 127648 09/08/2020 LEGAL- CORONA VIRUS 100-01-5230 202,50 Vendor OTTOSEN DINOLFO HASENBALG & CASTALDO, LTD Total: 202,50 Vendor: PAGELS, NIKKI PAGELS, NIKKI 273087 09/08/2020 CXL 100-41-3634 90,00 Vendor PAGELS, NIKKI Total: 90.06 Vendor: POSTMASTER MCHENRY IL POSTMASTER MCHENRY IL INV0010391 09/08/2020 PERMIT 48000 REN 100-04-5310 240,00 Vendor POSTMASTER MCHENRY ILTotab 240,00 Vendor: SYNCB/AMAZON SYNCB/AMAZON 12318/10/20 09/08/2020 PD MTHLY 100-22-6210 449,26 Vendor SYNCB/AMAZON Total: 449,26 Vendor: TYLER TECHNOLOGIES TYLER TECHNOLOGIES 025-306829 09/08/2020 PEES MGMT SUITE MAINT 620-GO-5110 318,35 Vendor TYLER TECHNOLOGIES Total: 318,35 Vendor: US BANK EQUIPMENT FINANCE US BANK EQUIPMENT FINANCE 421863507 09/08/2020 PWCOPIER 620-00-6210 336,21 Vendor US BANK EQUIPMENT FINANCE Total: 336,21 Vendor: ZUKOWSKI ROGERS FLOOD & MCARDLE ZUKOWSKI ROGERS FLOOD & 144555 09/08/2020 CORPORATE 100-01-5230 4,671,25 ZUKOWSKI ROGERS FLOOD & 144558 09/08/2020 SUVADA, VERA ANN/3709 100-01-5230 277,50 ZUKOWSKI ROGERS FLOOD & 144559 09/08/2020 TRAFFIC 100-01-5230 5,991,45 ZUKOWSKI ROGERS FLOOD & 144560 09/08/2020 COVID 100-01-5230 1,341,25 ZUKOWSKI ROGERS FLOOD & 144561 09/08/2020 COVID-19 LAWSUIT 100-01-5230 740.00 Vendor ZUKOWSKI ROGERS FLOOD & MCARDLE Total; 13,021,45 Grand Total: 368,908,21 9/2/2020 12;56:30 PM Expense Approval Register Packet: APPKT01908 - 9-1-20 AP CKS Fund Summary Fund 100-GENERAL FUND 0- TOURISM FUND 225-ALARM BOARD FUND 270- MOTOR FUEL TAX FUND 510- WATER/SEWER FUND GO -EMPLOYEE INSURANCE FUND 620- INFORMATION TECHNOLOGY FUND 740- RETAINED PERSONNEL ESCROW 760- POLICE PENSION FUND Grand Total: Expense Amount 82,424,57 33,609,98 1,371,50 6,049,49 2,485,60 69,75 929,56 3,614.50 238,353,26 368,908,21 a McHenry, IL m V Vendor Name Payable Number Vendor: A -ABLE ALARM SERVICE INC A -ABLE ALARM SERVICE INC 66875 Vendor: ADAMS STEEL SERVICE & SUPPLY, INC ADAMS STEELSERVICE& 364120 ADAMS STEELSERVICE& 364199 ADAMS STEEL SERVICE& 364586 ADAMS STEEL SERVICE& 364644 Vendor: ADVANCED AUTOMATION AND CONTROLS INC ADVANCED AUTOMATION AND 20-3434 Vendor: ARIES INDUSTRIES INC ARIES INDUSTRIES INC 399426 Vendor: AT&T AT&T 9184 8/19/20 AT&T 9184 8/19/20 AT&T 96158-16-20 Vendor: AUTO TECH CENTERS INC AUTO TECH CENTERS INC 305434 Vendor: BATTERIES PLUS H456 BATTERIES PLUS 9456 P29836828 Vendor: BUCK BROS INC BUCK BROSINC 269431 BUCK BROS INC 270035 BUCK BROS INC 270855 Vendor: BUSS FORD SALES BUSS FORD SALES 5038660 BUSS FORD SALES 6066134 Vendor: CABAY &COMPANY INC CABAY&COMPANY INC 63053 CABAY & COMPANY INC 63079 CABAY & COMPANY INC 63143 CABAY & COMPANY INC 63182 Expense Approval Register #2 List of Bills Council Meeting - 9-8-2020 Post Date Description (Item) Account Number Amount 09/O8(2020 Park Improvements: Veteran's 400-00-8800 1,323.20 Vendor A -ABLE ALARM SERVICE INC Total: 10323,20 09/08/2020 streets 100-33-6115 135.00 09/08/2020 Clarifier NIRepair Supplies 510-32-5375 19,60 09/08/2020 Compressed Nitrogen 510-32-6110 50,75 09/08/2020 Materials for -Plant I(Green 510-31-5370 76.50 Vendor ADAMS STEEL SERVICE & SUPPLY, INC Total: 281,85 09/08/2020 Sonic wall, PLC batteries, comm 510-32-5110 11035,00 Vendor ADVANCED AUTOMATION AND CONTROLS INC Total: 1,035.00 09/08/2020 Camera lights repair 510-35-6110 11996,44 Vendor ARIES INDUSTRIES INC Total: 11996,44 09/08/2020 AT&T Network On Demand 620-00-5110 1,510.58 09/08/2020 AT&T Monthly Phone Invoice 620-00-5320 21039,13 09/08/2020 AT&T Fiber Internet 100M 620-00-5110 1,129.25 Vendor AT&T Total: 4,678.96 09/08/2020 315 100-22-5370 340,26 Vendor AUTO TECH CENTERS INC Total: 340,26 09/08/2020 SLA12-8F2 UPS Replacement 620-00-6110 526.80 Vendor BATTERIES PLUS H456 Total: 526.80 09/08/2020 640 510-32-5370 154.66 D9/08/2020 saws 100-33-5370 117.87 09/08/2020 chain saws 100-33-5370 165,81 Vendor BUCK BROS INCTotal: 438,34 09/08/2020 315 100-22-5370 106.26 09/08/2020 901 100-33-5370 1,255.23 Vendor BUSS FORD SALES Total: 1,361.49 09/08/2020 Sanitizingwipes 40G-00-6111 373,50 09/08/2020 Cleaning Supplies 400-00-6111 879.49 09/08/2020 Cleaning Supplies 400-00-6111 148.96 09/08/2020 Towels 100-03-5120 110,63 Vendor CABAY & COMPANY INC Total: 11512,58 Vendor; CINTAS CINTAS 5024511366 09/O8/2020 Vendor: COMCAST CABLE COMCAST CABLE 05958-24-20 COMCAST CABLE 79208-27-20 Shop Supplies 100-45-5110 73.63 09/08/2020 Lakeland Park Community 620-00-5310 258.40 09/OS/2020 CH Monthly Internet 620-00-5110 164.85 Vendor COMCAST CABLE To[al: 423.25 9/2/2020 1:06:28 PM Expense Approval Register Packet: APPKT01911- 9-8-2020 RECF INVOICE Vendor Name Payable Number Post Date Description (item) Account Number Amount Vendor: CONCENTRIC INTEGRATION,LLC CONCENTRIC INTEGRATION,LLC 0215709 09/08/2020 VPN replacement for SCADA 510-31-5110 2,883.29 Vendor CONCENTRIC INTEGRATION,LLC Total: 2,883,29 Vendor: CONNEY SAFETY PRODUCTS CONNEY SAFETY PRODUCTS 05894150 09/08/2020 Disinfectant Spray 100-42-6110 243,45 Vendor CONNEY SAFETY PRODUCTS Total: 243,45 Vendor: CUMMINS INC CUMMINSINC F2-72635 09/08/2020 Emergency generator repair at 510-32-5380 1,738.03 Vendor CUMMINS INCTotal: 10738,03 Vendor: CURRAN CONTRACTING COMPANY CURRAN CONTRACTING 19584 09/08/2020 N70 Surface - STS - 43739 100-33-6110 24,92 CURRAN CONTRACTING 19600 09/08/2020 N70 Surface - STS -B43807 100-33-6110 93.45 CURRAN CONTRACTING 19818A 09/08/2020 N50 Surface - UTY - 44392 510-35-6110 60.97 CURRAN CONTRACTING 19818 09/08/2020 N50 Surface - UTY - 44387 510-35-6110 7031 Vendor CURRAN CONTRACTING COMPANYTotal: 249.65 Vendor: DIRECT FITNESS SOLUTIONS DIRECT FITNESS SOLUTIONS 0560134-IN 09/08/2020 Equipment Repair 400-40-5375 41421,92 DIRECT FITNESS SOLUTIONS 0560261-IN 09/08/2020 Equipment Repair 400-40-5375 184,00 Vendor DIRECT FITNESS SOLUTIONS Total: 4,605.92 Vendor: DURA WAX COMPANY INC, THE DURA WAX COMPANY INC, THE 408962 09/08/2020 Shop Supplies 100-45-6110 145,92 Vendor DURA WAX COMPANY INC, THE Total: 145.92 Vendor: ED'S RENTAL &SALES INC ED'S RENTAL &SALES INC 303056-1 09/08/2020 Auger rental 100-33-6110 100,00 ED'S RENTAL & SALES INC 303190-1 09/08/2020 Auger rental 100-33-6110 60.00 Vendor ED'S RENTAL & SALES INC Total: 160,00 Vendor: EJ USA INC EJ USA INC 110200059946 09/08/2020 Hydrants 510-35-6110 4,465.70 Vendor EJ USA INCTotal: 4,465.70 Vendor: FISCHER BROS FRESH FISCHER BROS FRESH 13920 09/08/2020 Ready Mix Concrete UTY 510-35-6110 551.50 FISCHER BROS FRESH 13925 09/08/2020 Ready Mix UTY 413925 510-35-6110 501.25 FISCHER BROS FRESH 13936 09/08/2020 Ready Mix Concrete STS- 100-33-6110 395.75 FISCHER BROS FRESH 13954 09/08/2020 Ready Mix Concrete STS 13954 100-33-6110 794.50 FISCHER BROS FRESH 13983 09/08/2020 Ready Mix Concrete STS 100-33-6110 551.50 Vendor FISCHER BROS FRESH Total: 2,794.50 Vendor: FREUND & SON INC, S H FREUND & SON INC, S H 8-5-2020 09/08/2020 Vet's Park Bathroom Final 280-41-8800 99,429.58 Vendor FREUND & SON INC, S H Total: 99,429.58 Vendor: GALLS LLC GALLS LLC 016195649 09/O8(2020 UNIFORM ORDER - SEXTON 100-22-4510 122.56 GALLS LLC 016195659 09/O8/2020 BIKE UNIFORM-CAREY 100-22-6130 56.02 GALLS LLC 016195667 09/08/2020 UNIFORM ORDER -SEXTON 100-22-4510 154.99 GALLS LLC 016196097 09/08/2020 UNIFORM ORDER -CAREY 100-22-4510 72.45 GALLS LLC 016220300 09/08/2020 UNIFORM ORDER - POLIDORI 100-22-4510 159,99 GALLS LLC 016241925 09/08/2020 BIKE UNIFORM SHIRT -CAREY 100-22-6110 49.01 GALLS LLC 016241927 09/08/2020 UNIFORM ORDER -HUBBARD 100-23-6110 417.10 GALLS LLC 016254076 09/08/2020 RANGEBAG 100-22-6110 33,99 GALLS LLC 016262251 09/08/2020 UNIFORM ORDER - HUBBARD 100-23-6110 17,86 GALLS LLC 016288379 09/08/2020 UNIFORM ORDER - SEXTON 100-22-4510 138.31 GALLS LLC 016288766 09/08/2020 UNIFORM ORDER -SEXTON 100-22-4510 33.40 GALLS LLC 016298838 09/08/2020 UNIFORM ORDER - FISHER 100-22-4510 73,30 GALLS LLC 016298865 09/08/2020 UNIFORM ORDER -P. PRATHER 100-22-4510 144,95 Vendor GALLS LLCTotal: 1,473.93 9/2/2020 1;06;28 PM Expense Approval Register Packet: APPKT01911- 9-8-2020 RECF INVOICE Vendor Name Payable Number Post Date Description (Item) Account Number Amount Vendor: GOVCONNECTION, INC GOVCONNECTION, INC 70196683 09/08/2020 AutoCAD LT License (Prorated) 620-00-6110 109,05 Vendor GOVCONNECTION, INCTotal: 109,05 Vendor: HAWKINS INC HAWKINS INC 4774547 09/08/2020 Chemical Delivery 510-32-6110 41667,85 HAWKINS INC 4781237 09/08/2020 chemical delivery august 510-31-6110 41277,30 Vendor HAWKINS INCTotal: 8,945,15 Vendor: HRGREEN HRGREEN 136529 09/08/2020 Well 8-RAW Water DECO 510-31-5110 4,988.50 HRGREEN 137046 09/08/2020 2020 Biennial Bridge 100-33-5110 51499,75 HRGREEN 137187 09/08/2020 Home& Ramble Stormwater 100-33-5110 41099,50 Vendor HRGREEN Total: 14,587.75 Vendor: IN -PIPE TECHNOLOGY COMPANY INC IN -PIPE TECHNOLOGY 1774 09/08/2020 Monthly service fee 510-32-5110 7,750.00 Vendor IN -PIPE TECHNOLOGY COMPANY INCTotal: 70750,00 Vendor: INTERSTATE ALL BATTERY CENTER INTERSTATE ALL BATTERY 1903701040034 09/08/2020 1,5 Meter BFP UPS Batteries 510-32-5375 98,60 Vendor INTERSTATE ALL BATTERY CENTER Total: 98,60 Vendor: JETTS HEATING & AIR INC JETTS HEATING &AIR INC 4715908 09/08/2020 HVAC aaon unit 4 repair 400-00-5375 210,00 Vendor LETTS HEATING & AIR INC Total: 210,00 Vendor: KIESLER'S POLICE SUPPLY INC KIESLER'S POLICE SUPPLY INC Q113205 09/08/2020 AMMUNITION 100-22-6110 6,944.00 Vendor KIESLER'S POLICE SUPPLY INCTotal: 6,944.00 Vendor: KIMBALL MIDWEST KIMBALLMIDWEST 8146781 09/08/2020 new trucks 100-45-5370 225.30 KIMBALLMIDWEST 8165875 09/08/2020 kimball stock 100-33-5370 295,53 KIMBALLMIDWEST 8181931 09/08/2020 kimbail stock 100-33-5370 381,10 Vendor KIMBALL MIDWESTTotah 90133 Vendor: KOMLINE-SANDERSON KOMLINE-SANDERSON 42047466 09/08/2020 Case of Grease -Sludge Dryer 510-32-5375 769,08 Vendor KOMLINE-SANDERSON Total: 769,08 Vendor: MAD BOMBER FIREWORKS MAD BOMBER FIREWORKS 1463-64 09/02/2020 Fireworks 100-41-6920 25,000.00 Vendor MAD BOMBER FIREWORKS Total: 25,000.00 Vendor: MCHENRY POWER EQUIPMENT INC MCHENRY POWER EQUIPMENT 399661 09/08/2020 paint striper 100-45-5370 38.39 Vendor MCHENRY POWER EQUIPMENT INC Total: 38,39 Vendor: MCMASTER-CARR SUPPLY CO MCMASTER-CARR SUPPLY CO 43817206 09/08/2020 Discharge Hose for Dryer over 510-32-6110 119,65 Vendor MCMASTER-CARR SUPPLY CO Total: 119.65 Vendor: MEADE INC MEADE INC 692709 09/08/2020 Traffic Signal Locates - 692709 100-33-5110 85,57 MEADE INC 693482 09/08/2020 Traffic Signals Locate#693482 100-33-5310 82.77 MEADE INC 693588 09/08/2020 Traffic Signal Repair 693588 100-33-5110 582,28 Vendor MEADE INCTotal: 750.62 Vendor: MENDEZ LANDSCAPING & BRICK PAVERS INC MENDEZ LANDSCAPING& 8749 09/08/2020 CITY HALL MAINTENANCE 100-03-5120 360,00 MENDEZ LANDSCAPING& 8765 09/08/2020 Riverwalk Maintenance 100-45-5110 400.00 Vendor MENDEZ LANDSCAPING & BRICK PAVERS INCTotal: 760,00 Vendor: METRO DOOR AND DOCK INC METRO DOOR AND DOCK INC E14152 09/08/2020 door repair 100-33-5115 345.50 METRO DOOR AND DOCK INC E14182 09/08/2020 SE door repair 100-33-5110 823.49 Vendor METRO DOOR AND DOCK INC Total: 1,168.99 9/2/2020 1:06:28 PM Expense Approval Register Packet: APPKTO1911- 9-8-2020 RECT INVOICE Vendor Name Payable Number Post Date Description (item) Account Number Amount Vendor: MIDWEST HOSE AND FITTINGS INC MIDWEST HOSE AND FITTINGS 203368 09/08/2020 Shop Supplies 100-45-6110 76,74 Vendor MIDWEST HOSE AND FITTINGS INCTotal: 76,74 Vendor: MIDWEST METER INC MIDWEST METER INC 0122967-IN 09/08/2020 water meters 510-31-6110 1,320.98 MIDWEST METER INC 0124265-IN 09/08/2020 water meters 510-31-6110 1,378,25 Vendor MIDWEST METER INC Total: 21699,23 Vendor: MULCH CENTER, THE MULCH CENTER, THE 148155 09/08/2020 Playground Mulch 100-45-6110 1,400.00 Vendor MULCH CENTER, THE Total: 1,400,00 Vendor: OFFICIAL FINDERS LLC OFFICIAL FINDERS LLC 2509 09/08/2020 Invoice 2509 Officials Softball 100-47-5110 648,90 Vendor OFFICIAL FINDERS LLC Total: 648,90 Vendor: PETROCHOICE LLC PETROCHOICE LLC 11356159 09/08/2020 New fuel pump 510-32-5375 1,067.40 PETROCHOICE LLC 50294775 09/08/2020 Fuel - CITY - 50294775 510-35-6250 83,60 PETROCHOICE LLC 50294788 09/08/2020 FUEL BILL 100-03-6250 34,54 PETROCHOICE LLC 50294789 09/08/2020 Fuel - WW - 50294789 510-32-6250 252,60 PETROCHOICE LLC 50294790 09/08/2020 Fuel - WTR - 50294790 510-31-6250 143,45 PETROCHOICE LLC 50294791 09/08/2020 Fuel 100-45-6250 537.43 PETROCHOICE LLC 50294792 09/08/2020 Fuel - STS - 50294792 100-33-6250 265.53 PETROCHOICE LLC 50294793 09/08/2020 FUELS0294793 100-22-6250 1,928.99 PETROCHOICE LLC 50298467 09/08/2020 55 gal drum 15W-40 Diesel Oil 510-32-5380 764,90 PETROCHOICE LLC 50298529 09/08/2020 REPAIR NOZZLE 100-22-6250 100.00 PETROCHOICE LLC 50304592 09/08/2020 Fuel - UTY - 50304592 510-35-6250 499,67 PETROCHOICE LLC 50304610 09/08/2020 Fuel Bill 100-03-6250 33,21 PETROCHOICE LLC 50304611 09/08/2020 Fuel - WW - 50304611 510-32-6250 353,75 PETROCHOICE LLC 50304612 09/08/2020 Fuel - WTR - 50304612 510-31-6250 105,26 PETROCHOICE LLC 50304614 09/08/2020 Fuel - STS - 50304614 100-33-6250 822.53 PETROCHOICE LLC 50304615 09/08/2020 FUEL50304615 100-22-6250 2,221.44 Vendor PETROCHOICE LLC Total: 91214,30 Vendor: R&S FENCE COMPANY R&S FENCE COMPANY 8-10-2020 09/08/2020 Court St Parking Lot Fence 100-33-6110 5,565.58 R&S FENCE COMPANY 8-20-20 09/08/2020 Tool rental 100-33-6110 125,00 Vendor R&S FENCE COMPANYTotal: 5,690.58 Vendor: ROBINSON ENGINEERING LTD ROBINSON ENGINEERING LTD 20070209 09/08/2020 RIPI Grant Assistance- 510-35-5110 4,082,25 Vendor ROBINSON ENGINEERING LTD Total: 40082,25 Vendor: ROTARY CLUB OF MCHENRY ROTARY CLUB OF MCHENRY 3267 09/08/2020 QUARTERLY DUES 100-22-5410 93.75 Vendor ROTARY CLUB OF MCHENRY Total: 93,75 Vendor: SCHOPEN PEST SOLUTIONS INC SCHOPEN PEST SOLUTIONS INC 8584 09/08/2020 PESTMAINTENANCE 100-03-5120 162,00 Vendor SCHOPEN PESTSOLUTIONS INCTotal: 162,00 Vendor: SENCOMMUNICATIONS INC SENCOMMUNICATIONS INC IN0976061 09/08/2020 HEADSET REPAIR 100-23-6110 25,00 Vendor SENCOMMUNICATIONS INCTotal: 25,00 Vendor: THOMPSON ELEVATOR INSPECTION SERV INC THOMPSON ELEVATOR 20-2154 09/08/2020 Elevator Inspection #20-2154 100-33-5115 185,00 Vendor THOMPSON ELEVATOR INSPECTION SERV INC Total: 185000 Vendor: TOPS IN DOG TRAINING CORP TOPS IN DOG TRAINING CORP 22717 09/08/2020 K9 FOOD/BOARDING 100-22-6310 456,92 Vendor TOPS IN DOG TRAINING CORP Total: 456,92 Vendor: ULINE DUNE 122320235 09/09/2020 Saftey Supplies 510-32-6110 199,80 9J2/2020 1:06:28 PM Expense Approval Register Packet: APPKT01911- 9-8-2020 RECT INVOICE Vendor Name Payable Number Post Date Description (Item) Account Number Amount ULINE 123359951 09/08/2020 Janitorial Supplies 510-32-6110 247,53 Vendor ULINE Total: 447.33 Vendor: ULTRA STROBE COMMUNICATIONS INC ULTRASTROBE 077761 09/08/2020 440 100-33-5370 50.00 Vendor ULTRA STROBE COMMUNICATIONS INC Total: 50,00 Vendor: XYLEM WATER SOLUTIONS USA INC XYLEM WATER SOLUTIONS USA 3556B31194 09/08/2020 New pump for Millstream Lift 510-32-5380 61439,60 Vendor XYLEM WATER SOLUTIONS USA INC Total: 61439,60 Grand Total: 232,006.58 9/2/2020 1:06:28 PM Expense Approval Register Packet: APPKT01911- 9-8-2020 RECF INVOICE Fund Summary Fund 100-GENERAL FUND 280- DEVELOPER DONATION FUND 400- RECREATION CENTER FUND 510- WATER/SEWER FUND 620- INFORMATION TECHNOLOGY FUND Grand Total: E%pense Amount 66,083,85 99,429,58 7,541.07 53,214,02 5,738,06 232,006.58 r: 4.......K. N1'''. Wayne Jett,Jr. Mayorrok City of McHenry McHenry Municipal Center 333 Green Street C- McHenry, Illinois 60050 McHenr Phone: (815) 363-2100 www.cityofmchenry.org REGULAR AGENDA SUPPLEMENT DATE: September 8, 2020 TO:McHenry City Council FROM: Wayne Jett, Jr., Mayor RE:Motion to approve the transfer of a Class C liquor license from JOG Gasoline, Inc., located at 4608 W Crystal Lake Road, to Pazo Oil LLC. ATT: Application and supporting documentation AGENDA ITEM SUMMARY: Mr. Dandona has submitted an application for the transfer of the Class "C" liquor license for a business currently located at 4608 W Crystal Lake Road, which is currently operated by JOG Gasoline, Inc. BACKGROUND: The Class "C" liquor license permits the retail sale of packaged alcoholic liquor only. No consumption of alcoholic liquor shall be permitted on the premises. Mr. Dandona is in the process of purchasing the gas station and will take over operations of the business. He will also be the onsite manager and business contact, and will be given 30 days to find a Business Agent that lives within 10 miles of the City of McHenry. ANALYSIS: All required paperwork was submitted and he has been fingerprinted by McHenry Police. The license would be revoked due to an unsuccessful background check or the inability to secure a viable Business Agent within 30 days of the beginning of operation. RECOMMENDATION: Therefore, if Council concurs, it is recommended a motion be made to approve the transfer of a Class C liquor license from JOG Gasoline, Inc., located at 4608 W Crystal Lake Road, to Pazo Oil LLC. The City of McHenry is dedicated to providing its citizens, businesses, and visitors with the highest quality of programs and services in a customer-oriented, efficient. and fiscally responsible manner. age I la HENRY e ,'rit CITY OF MC HENRY APPLICATION FOR LIQUOR LICENSE This section to he completed by McHenry City Stall Iaiiii es'Ntiltitie`ir FN.Rec&lved: ill i License Issue Date: - Daft Fee Received: A License Effective Date:- Dati:Recept issued: Piiyh'isht Type: (Cash, Cashiers Check;'Certified Check) Check Number. Notice:All Liquor License Applications are to be filed with the Office of the Mayor. All licenses expire on April 301"following the data of issuance. ALL SECTIONS OF THIS APPLICATION MUST BE FILLED OUT TRUTHFULLY AND IN THEIR ENTIRITY. . IF A SECTION DOES NOT APPLY TO YOU MARK "NiA". ALL REQUIRED ATTACHMENTS MUST BE SUBMITTED WITH THIS APPLICATION. Section 1: License Classification Date of Application: I U 2U Z O License Type:inlass A,B of,.or F __ c.. ICateri Endorsement es/No) New License o Transfer of Ucensp(select one) ter. FtSoctian1:Applicant 13ut ness Name of Business Address Telephone Enid'Aadress5 2-0 QIL_ k-L_L. r c i'_ '7rtl. 4 U l- p ' 0144 5ection3:Business Type Type of Business:(Select One:Club,Sole Proprietor,Partnership,LLC or Corporation) M {61 Attached Business FlilnQ with State L L_ L Principal Type of Business:(identify One:Bar,restaurant,retail store,hotel restaurant,gas station,gaming parlor,etc.) Do you intend to apply for gaming machines through the State of Illinois?(Yes or No) i i 0 f List State of filing for LLC,Corporation,Partnership and Sole Pro•rietor: 0 " —I 0 How long has the sole proprietor,Club,Partnership,Corporation or LLC been In the business of Li 0 5 Z selll • alcohol?(List Date) Section 4:Zoning 4::. • WhatZooln -Classification is business property?(Select One: Section 5: Business Location Histo x_ Date on which the business opened or will open at the above Business Location: 5 is the property at which the applicant business Is located owned or leased by the applicant? ow N } if Leased please list owner information below: Pirsoif or.Business Name: Address': 1 Phone&Email: A copy of the property lease agreement must be attached to this application.Please mark N/A or Attached H ,4'. If property is owned by a land trust,trustee must file affidavit disclosing names and addresses of all beneficial owners and percentage of Interest.Please mark N/A or Attached Is the location of applicant's business for which license Is sought within one hundred feet of any church;school N O except Institutions of higher education),hospital,funeral home,home for aged or indigent persons or for veterans and their families or any military or naval station?(Yes or No) How man .•iivate •roperty • rkin .. ces are associated with the business location?(LIST NUMBER) Section 6: Business Agent list Agent:An Agent is the authorized representative of the Licensee who has supervisory authority over all employees of the license premises.An agent may be an owner,partner,member,or designated manager. Full Name DOS Home Address Citizenship If Natunllied: Birth or ttst date&plan of Naturalization '. naturalization jj,,{{. ( L1+ -iJ r4 gti i-, . f t f-i)(`3 2\ Pa.:2of7 Section 7: Business History Have the applicant(s)(including all 5%or higher owners),corporation,LLC,or partnership ever engaged In the business or sale of alcoholic liquor at arj other location?(Yes or No) if Yes,list information below. Name of Person Name of associated DBA Name Address corporation,LLC or partnership Section B: Business Licensing and Filling Identification Illinois State Liquor License Number Applicant's Retailer's Occupational tax(ROT)Registration Number Has applicant been delinquent In the payment of the Retailer's Occupational Tax(Sales Tax)?(Yes or No) R If you answered"Yes" above provide a reason otherwise mark N/A. Section 9:Insurance list the name and address of dram shop insurance company along with thepolicy numbers)for both the applicant business and the owner of the building In which the alcoholic liquor will be sold for the duration of the license. Name: Address: Policy Number Section 10: Background Questiomaire The following questions are In relation to the McHenry City Liquor Ordinance and Illinois law as it pertains to liquor licensing. All questions must be answered honestly. Failure to do so may disqualify you from the application process. are you familiar with all the laws of the United States,State of Illinois and ordinances of the City of McHenry v spertainingtothesaleofalcoholicliquor;and will you abide by them?(Yes or No) Will you maintain the entire premises in a safe,clean and sanitary manner free from conditions,which might ice-5causeacddents?(Yes or No) Will you attempt to prevent rowdiness,fights and disorderly conduct of any kind and immediately notify the McHenry Police Department Is any such events take place?fres or No) 1 l: Has any manufacturer,importing distributor or distributor of alcoholic liquors directly or indirectly paid of opi+eed to pay for this license,advanced money or anything else of value or any credit(other than merchandising credit U In the ordinary course of business for a period not in excess of 90 days),or Is such a person directly or Indirectly Interested in the ownership,conduct or operation of the place of business? (Yes or No) Have any of the applicants,including all listed agents andjartners who have a minimum Oa 5%ownership In l the business been convicted of ony violation of any law pertaining to okoholk liquors?(Yes or No)0 If"Yes"provide the name of the applicant and a description of the violation Name Description:Include dat;and looitlon Have any of the applicants,Including all listed agents and partners who have a minimum of a 5%owneishlp in; +I the business been convicted of a felony or misdemeanor?(Yes or Not rU If"Yes"provide the name of the applicant and a description of the violation Name Description:Indud%date and location. Pa.-1ot7 Section 10 Continued:Background Questionnaire WUI you and all your employees refuse to serve or sell alcoholic liquor to an Intoxkatedlerx'oii or toil minor? fifes'orNo) lc.—. Has any owner(s)or member(s)of a Partnership been issued a federal gaming devise stamp or a federal wagering stamp by the federal government for the current tax period? If a Corporation,has any officer, manager,or director thereof;or,any stockholder owning in the aggregate more than twenty(20)percent of the study been issued a federal wagering devise stomp or a federal wagering stamp by the federal government for the current tax period?(Yes or No) t(("Yee provide name(s),dates)and location ilii) .: Name Date and Location of Issuance Q'idsi1 Have you,or any partner,or owner of S%or more shares of the business or Agent,ever had a liquor license Norevokedorsusended?.(Yes or No). If"Yes"providename(s),dateW and location Name Date and Location of Offense is any Indhr dual who is directly or indirectly Interested lir'appllcont's pia`ieof basinso law-enfoieJn officlni or elected publk official(mayor,alderman,and member of any city commission,committee or boaid)7=(Yes or No) ki If"Yes"provide the name of the Individual and there address and telephone.- ' Name Address and Telephone- s Have yo`u ever been convicted Of a gambling offense(If a paitnenhip of corporation;lnciude all partners;owneis_ ' f,+ 0of5%or more shares of the corporation and the local manager)?(Yes or No) V if"Ye?'provide the name of the individual and the date/location of theoffense. Name Date and Location of Offense ii Pape 4 of 7 Section 11:Ownership Records Ust of I owners,' rtners,`stock holders and members must he lited'hllow. tOwtier Mime C- Percentage of Ownership Citizenship(Birth or Naturalization) JJ(-rall}(44'1 w") If Naturalized:List time&place of naturalization Employment History for Last 10 Years yam,' Employer Occupation 1111MPF Address IINSMOMMirDatas' y U P o IL ( PRcs l uu 1516 5 Gw i-D DOB Address Phone Percentage of Ownership Citizenship(Birth or Naturalization) lff.Naturalized:List time&place of naturalization Employment History for Last 10 Years MIA. Employer Occupation Address Ditest.:." Name DOB Address Phone Percentage of Ownership_ Citizenship(Birth or Naturalliation) If Naturalized:List time&place of naturalization Employment History for Last 10 Years Employer Occupation Address Date 1 Page 7 of 7 ilio:M UNa iti_ IDOB Addiiis Phone, I Pircentaje of Ownership Citizenship(Birth or.Naturaliratlon) If Nittirralired:list time&place of naturalisation:-7. Employment HistolVfor last 10 Years Employer Occupation Address Oates Section 12:Required Attachments Business Drams 'Ineurance Property Dram Shop insurance'(If Applicable) Business Filing Paperwork with State:(Club,Sole Proprietor,Partnership,LLC or Corporation State Liquor.License Building Lease Agreement(If Applicable) I,the undersigned,being first duly sworn,deposes and says that I(we),have read the above and foregoing Application,caused the answers to be provided thereto and all of the information given on said Application to be true and correct,and consent to Investigation and background check by the Local Liquor Control Commissioner or his designee and agree to comply with all City Ordinances and the rules stated on this application. SOLE PROPRIETOR: Signature of Applicant Print Name PARTNERSHIP: Authorized Agent of the Partnership) Signature Print Name The CORPORATION: Authorized Agent of the Corporation) gr)-14)-- Signature p D Ao Print Name At J • V v I/e4 4 of Title AGENT:(Must be signed by agent also If agent Is not a owner) Signature of Local Manager Print Name Illinois Form LLC m5,5 Limited Liability Company Act FILE#08797323ArticlesofOrganization FILED Secretary of State Jesse White Department of Business Services Filing Fee:150 JUN 05 2020 Limited Liability Division Jesse Whitewww.cyberdtiveillinois.com Approved By: TLB Secretary of State 1. Limited Liability Company Name: PAZO OIL LLC 2. Address of Principal Place of Business where records of the company will be kept: 1515 SEWARD ST SCHAUMBURG, IL 60193 3. The Limited Liability Company has one or more members on the filing date. 4. Registered Agent's Name and Registered Office Address: PRITPAL DANDONA 1515 SEWARD ST SCHAUMBURG, IL 60193-4626 5. Purpose for which the Limited Liability Company is organized: The transaction of any or all lawful business for which Limited Liability Companies may be organized under this Act.° 6. The LLC is to have perpetual existence. 7. Name and business addresses ofall the managers and any member having the authority of manager: DANOONA PRITPAL 1515 SEWARD ST SCHAUMBURG,IL 60193 8. Name and Address of Organizer I affirm, under penalties of perjury, having authority to sign hereto,that these Articles of Organization are to the best of my knowledge and belief,true, correct and complete. Dated: JUNE 05,2020 PRITPAL DANDONA 1515 SEWARD ST SCHAUMBURG, IL 60193 This document was generated electronically at www cyberdrivelllinots.00m 1,1 N i Tp EIN Assistant Your Progress: 1.Identity 2.Authenticate 3.Addresses 4.Details S.EIN Congratulations!The EIN has been successfully assigned. Help Topics e Can the EEINAssigned: 85-1331859 the confirt received?Legal Name: PAZO OIL LLC The confirmation letter will be mailed to the applicant.This letter wilt be the applicant's official IRS notice and will contain important information regarding the EIN.Allow up to 4 weeks for the letter to arrive by mall. We strongly recommend you print this page for your records. Click"Continue"to get additional information about using the new EIN. I Continue>> DATE IMMJODNYYY) ACORD® CERTIFICATE OF LIABILITY INSURANCE 8/11/2020 THISERTIFICATE IS ISSUED AS A MATTER OF INFORMATION ONLY AND CONFERS NO RIGHTS UPON THE CERTIFICATE HOLDER.THIS CERTIFICATE DOES NOT AFFIRMATIVELY OR NEGATIVELY AMEND,EXTEND OR ALTER THE COVERAGE AFFORDED BY THE POLICIESBELOW. THIS CERTIFICATE OF INSURANCE DOES NOT CONSTITUTE A CONTRACT BETWEEN THE ISSUING INSURER(S),AUTHORIZED REPRESENTATIVE OR PRODUCER,AND THE CERTIFICATE HOLDER. IMPORTANT: If the certificate holder Is an ADDITIONAL INSURED,the pollcy(los)must bo endorsed. If SUBROGATION IS WAIVED,subject tothetermsandconditionsofthepolicy,curtain policies may require on endorsement. A statement on this certificate does not confer rights to the certificate holder in lieu of such endorsemont(s). CUNIAC1 PRODUCER NAME Adrian Shaukal FAx A&S Insurance Services LLC kH ):630-306.2898 I(ac,Nel: 630.379.0042 _ Ty 750 Delacourte Ave ADDRESS: adnanaseoutiook.com INSURER(S)AFFORDING COVERAGE NAIC X Bolingbrook IL 60490 INSURER A: Allied Insurance INSURED INSURER B: Pan Oil LLC INSURER C 4608 W Crystal lake Road INSURER D: INSURER E: McHenry IL 60050 INSURER F: COVERAGES CERTIFICATE NUMBER: REVISION NUMBER: THIS IS TO CERTIFY THAT THE POLICIES OF INSURANCE LISTED BELOW HAVE BEEN ISSUED TO THE INSURED NAMED ABOVE FOR THE POLICY PERIODINDICATEDNOTWITHSTANDINGANYREQUIREMENT,TERM OR CONDITION OF ANY CONTRACT OR OTHER DOCUMENT WITH RESPECT TO WHICH THISCERTIFICATEMAYBEISSUEDORMAYPERTAIN.THE INSURANCE AFFORDED BY THE POLICIES DESCRIBED HEREIN IS SUBJECT TO ALL THE TERMS, EXCLUSIONS AND CONDITIONS OF SUCH POLICIES LIMITS SHOWN MAY HAVE BEEN REDUCED BY PAID CLAIMS 1NSR AWL SUER JOLICY EFF POLICY EXP LIMITS LTR I TYPE OF INSURANCE INS° WVD!POLICY NUMBER I(MM(DD/YYYY)I(MMIDOIYYYY x COMMERCIAL GENERAL LIABILITY •EACH OCCURRENCE S 1,000,000 DAMACie'UKtN ILD s 300,000 CLANSMAN 13CI OCCUR PREMISES(Ea occurrence) MED EXP(Any one person) S 5,000 A i ACPBP013200178111 8/12/2020 8/12/2021 PERSONAL&ADV INJURY S 1,000,000 GENT_AGGREGATE LIMIT APPLIES PER 1 GENERAL AGGREGATE S 2,000,000 I PRO-PRODUCTS•COMP/OP AGG S 2,000,000II I X POLICY JECT LOC OTHER I S AUTOMOBILE LIABILITY COMaBINEEDtSINGIL LIMIT S 1,000,000 ANY AUTO BODILY INJURY IPer person) S I A AUTOSALL NED AUTOS ACPBA013200178111 ACPBA013200178111 8/12/2020 18/12/2021 BODILY INJURY(Per accident) S NON-OWNED PROPERTYDAMAGE S x HIRED AUTOS K AUTOS IPer acc.denq I S 3 UMBRELLA LIAB 1 X OCCUR EACH OCCURRENCE S 1,000,000 A EXCESS LIAB CLAIMS-MADE ACPCU013200178111 8/12/2020 8/12/2021 AGGREGATE S 1,000,000 DED I RETENTIONS S WORKERS COMPENSATION PER 1 DIN- STATUTE . ,ER AND EMPLOYERS'LIABILITY YIN ANY PROPRIETOR/PARTNER/EXECUTIVE NIA E L EACH ACCIDENT S OFFICERIMEMBER EXCLUDED? Mandatory in NH) I E L DISEASE-EA EMPLOYEE S If yes,describe under IDESCRIPTIONOFOPERATIONSbelow E L DISEASE-POLICY LIMIT S A Liquor Liability ACPBPO13200178111 8/12/2020 8/12/2021 Limit:31,000,000 DESCRIPTION OF OPERATIONS I LOCATIONS I VEHICLES(ACORD 101.Additional Remarks Schedule,may be attached If more space is required) CERTIFICATE HOLDER CANCELLATION SHOULD ANY OF THE ABOVE DESCRIBED POLICIES BE CANCELLED BEFORE THE EXPIRATION DATE THEREOF,NOTICE WILL BE DELIVERED IN ACCORDANCE WITH THE POLICY PROVISIONS. Illinois Liquor Control Commission 100 W Randolph Street AUTHORIZED REPRESENTATIVE Suite 7-801 Chicago IL 60601 A 1444,S 544 1 1988-2014 ACORD CORPORATION. All rights reserved. ACORD 26(2014101) The ACORD name and logo are registered marks of ACORD Verify that all of your Illinois Business Authorization information is correct. Verify that the information below correctly represents your business location. In particular,be sure to verify that the information correctly represents whether you are within or outsideofamunicipality. If you have registered for Sales and Use Tax and the retail sales location listed is incorrect, contact our Local Tax Allocation Division at 217 785-6518. McHenry McHenry County For all other corrections, contact our Central Registration Division at 217 785-3707. If all of the information is correct, cut along the dotted line(fits a standard 5"x 7"frame). Your authorization must be visibly displayed at the address listed. Do not discard the attached Illinois Business Authorization unless the information displayed is incorrect or until it expires. Your Illinois Business Authorization is an important tax document that indicates that you are registered or licensed with the Illinois Department of Revenue to legally do business in Illinois. f tivc.:,,mr c.-rri:<•.•c.tnr.c•T..;.:i,..ram r=.;,.. ..... - ---- -" r'— 4i OFFICIAL DOCUMENT State of Illinois-Department of Revenue OFFICIAL DOCUMENT Illinois Business Authorization w: , PAZO OIL LLC i Irw Loc.Code:056-0021-9-001 McHenry 4608 W CRYSTAL LAKE RD McHenry County MCHENRY IL 60050-5425 I Certificate of RegistrationExpirationDate:9 9/1/2021 Sales and use taxes and fees r 4366 9476) 1 d 4 U1LLINOISIZF:F:\L'E I IDirector I OFFICIAL DOCUMENT Issued Date: 09/01/2020 ...;J IDOR-50-A(R-02/19) P-000205 Department of Community Development McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 Phone: (815) 363-2170 Mc-Ienr www.cityofmchenry.org 815) 363-2173 cityofmchenry.org AGENDA SUPPLEMENT TO: Mayor and City Council FOR: September 8, 2020 Regular City Council Meeting FROM: Cody Sheriff, City Planner RE: Z-972 Conditional Use Permit to allow Outdoor Storage in Conjunction with a Towing Business. ATT: 1. Unapproved Planning and Zoning Commission Minutes dated August 19, 2020 2. Ordinance granting a Conditional Use Permit for 1302 Borden Street 3. Planning & Zoning Commission Staff Report 4. Application Packet AGENDA ITEM SUMMARY: The property owner is requesting approval of a Conditional Use Permit to allow outdoor storage in conjunction with a towing business for the property with a common address of 1302 Borden Street ("Subject Property"). BACKGROUND: On October 15, 2012, the McHenry City Council approved ORD-12-1605 which allowed outdoor storage on the Subject Property.The conditions of approval did not allow the outdoor storage of inoperable vehicles. By necessity, towing business operations will store inoperable vehicles from time-to-time. The new property owner (Krzysztof Lenart, DN N DRTY LLC) is requesting approval of a conditional use permit to allow the outdoor storage of inoperable vehicles in conjunction with a towing business. ANALYSIS: The surrounding land use and zoning consists of industrial and commercial properties.The primary concern regarding outdoor storage is largely aesthetic and potentially environmental from leaking automobile fluids.The property currently contains what appears to be an 8ft privacy fence facing Borden Street with a 6ft privacy fence on the north side, and a chain link fence that is screened by 1 Department of Community Development McHenry Municipal Center v 333 Green Street McHenry, Illinois 60050 Phone: (815) 363-2170 Fax: (815) 363-2173 Mrr www.cityofmchenry.org vegetation on the east and south side.The storage area is heavily screened from view by dense vegetation to the north (see photographs). Staff believes the storage area is appropriately screened for the proposed use. The storage area is composed of gravel and a condition was recommended that all leaking vehicles shall be stored indoors or on a paved surface. The property owners of the west property Advanced Auto Parts) contacted the City Planner and informed him that they do not object to the petitioner's request. No one from the general public provided comment at the meeting.The Planning& Zoning Commission unanimously recommended approval of the petitioner's request subject to the following conditions: 1. All outdoor storage shall be screened from view by a 6-foot privacy fence, at minimum, or by a landscaped barrier that is approved by the Zoning Administrator; 2. The property owners shall maintain and replace any existing landscaped screening that is damaged or destroyed; 3. All outdoor storage shall be related to the site's existing business operations; 4. The outdoor storage area shall not be accessible to the general public; 5. The outdoor storage of bulk materials is prohibited unless enclosed within a storage container; 6. The outdoor storage area shall be maintained in a neat and orderly fashion; 7. All leaking vehicles shall be stored indoors or on a paved surface; 8. All repair work shall be conducted indoors; and 9. All other federal,state, and local laws shall be met. If the City Council concurs it is recommended the attached ordinances granting a Conditional Use Permit to allow Outdoor Storage in conjunction with a towing business be approved Mayor and City Council vote-simple majority). 2 v Department of Community Development McHenry Municipal Center r. 333 Green Street McHenry, Illinois 60050 Phone: (815) 363-2170 Fax: (815)363-2173 Mc—lent www.cityofmchenry.org Unapproved Planning and Zoning Commission Minutes dated August 19, 2020 Public Hearing: Krzysztof Lenart, DN N DRTY LLC Z-972 1302 Borden Street Conditional Use Permit to Allow Outdoor Storage in Conjunction with a Towing Business. Chairman Strach called the Public Hearing to order at 7:35 p.m. regarding File No. Z-972 an application for a Conditional Use Permit to allow outdoor storage in conjunction with a towing business at the property located at 1208 N. River Rd. Chairman Strach stated Notice of the Public Hearing was published in the Northwest Herald and notices were mailed to all abutting property owners of record as required by ordinance. The subject property was posted. A Certificate of Publication and Affidavit of Compliance with notice requirements are on file in the City Clerk's Office. In attendance was Krzysztof Lenart, 1524 River Terrace Dr., Johnsburg (owner), who was sworn in. Mr. Lenart stated he is requesting a Conditional Use Permit in order to move his towing business to this location, which he purchased recently. City Planner Sheriff gave the Staff Report stating Mr. Lenart owns DN N DRTY LLC and is requesting approval of a Conditional Use Permit to allow outdoor storage in conjunction with his towing business at new property he acquired at 1302 Borden Street. In 2012 the McHenry City Council approved a conditional use permit on the property which allowed the outdoor storage with specific conditions on approval. "Condition Six: Outdoor storage of inoperable vehicles, as defined by city ordinances, is prohibited", specifically identifies inoperable vehicles as not permitted to be stored outdoors.The petitioners will need to have condition six removed in order to operate a towing business and will therefore need to receive approval of a Conditional Use Permit for outdoor storage of inoperable vehicles in conjunction with a towing business. Inoperable vehicles were defined and Planner Sheriff stated Mr. Lenart must meet the approval criteria for Conditional Uses, listed in the City of McHenry Zoning Ordinance and that overall, staff believes the proposed development is consistent with the City's Comprehensive Plan objectives and policies. Planner Sheriff received and distributed correspondence from Advance Auto stating they had no objection to this request as long as the property is kept clean and the outdoor storage is not visible. 3 y ram.. 4. 04.....) Department of Community Development McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 Phone: (815)363-2170 Fax: (815) 363-2173 Mdirizstei—otlerZ www.cityofmchenry.org Planner Sheriff stated the surrounding land use and zoning consists of industrial and commercial properties. The primary concern regarding outdoor storage is largely aesthetic and potentially environmental from leaking automobile fluids. The property currently contains privacy fencing and a chain link fence that is screened by vegetation on the east and south side.The storage area is heavily screened from view by dense vegetation to the north and Staff believes the storage area is appropriately screened for the proposed use. The storage area is composed of gravel. Outdoor storage should be limited to non-leaking vehicles in order to not contaminate the soil. Planner Sheriff stated the proposed use is consistent with the future land use map recommendation and the request appears consistent with the City's Comprehensive Plan and approval criteria for conditional uses. He further stated Staff does not object to the petitioner's request and recommends approval subject to appropriate conditions, as presented. Chairman Strach opened the floor to questions and comments from the commissioners. Commissioner Thacker asked if there would be any additional upgrades made to the building. Mr. Lenart stated he may put in fence screening on the south side of the property along the car wash to help with aesthetics. There were no other questions or comments. Chairman Strach opened the floor to questions and comments from the public. Being there was nobody in attendance from the public, Chairman Strach closed the public comment portion of the hearing at 7:50 p.m. Commissioner Lehman stated he was satisfied with the report and request. There were no other comments or questions. Motion by Lehman seconded by Gurda to recommend to the City Council with regard to File No. Z-972, approval of the petitioner's request for outdoor storage in conjunction with a towing business, subject to the following conditions: 1. All outdoor storage shall be screened from view by a 6-foot privacy fence, at minimum, or by a landscaped barrier that is approved by the Zoning Administrator; 2. The property owners shall maintain and replace any existing landscaped screening that is damaged or destroyed; 3. All outdoor storage shall be related to the site's existing business operations; 4. The outdoor storage area shall not be accessible to the general public; 5. The outdoor storage of bulk materials is prohibited unless enclosed within a storage container; 6. The outdoor storage area shall be maintained in a neat and orderly fashion; 7. All leaking vehicles shall be stored indoors or on a paved surface; 8. All repair work shall be conducted indoors; 9. All other federal, state, and local laws shall be met. 4 ft.... Department of Community Development McHenry Municipal Center e) ftft ft. 333 Green Street v i McHenry, Illinois 60050 Phone: (815) 363-2170 Fax: (815) 363-2173 MCHenrwww.cityofmchenry.org And that all the Approval Criteria for Conditional Uses of the City of McHenry Zoning Ordinance have been met. Roll Call: Vote: 7-ayes: Doherty,Thacker, Gurda, Lehman, Sobotta, Strach, and Walsh. 0-nays, 0- abstained, 0-absent. Motion Carried. Chairman Strach closed the Public Hearing regarding File No. Z-972 at 7:45 pm. 5 V Department of Community Development 41" McHenry Municipal Center v 333 Green Street McHenry, Illinois 60050 Phone: (815) 363-2170 McHenr wwwFax: (815) 363-2173 cityofmchenry.org ORDINANCE NO 20- AN ORDINANCE GRANTING A CONDITIONAL USE PERMIT TO ALLOW OUTDOOR STORAGE IN CONJUNCTION WITH A TOWING BUSINESS FOR THE PROPERTY LOCATED AT 1302 BORDEN STREET IN THE CITY OF MCHENRY, MCHENRY COUNTY, ILLINOIS WHEREAS, the City of McHenry, McHenry County, Illinois, is a home rule municipality as contemplated under Article VII, Section 6, of the Constitution of the State of Illinois, and the passage of this Ordinance constitutes an exercise of the City's home rule powers and functions as granted in the Constitution of the State of Illinois; and WHEREAS, a petition has been filed with the City by Krzysztof Lenart of 1524 River Terrace Drive, Johnsburg, IL 60051 ("PROPERTY OWNER") requesting approval of a conditional use permit to allow outdoor storage in conjunction with a towing business for the property located at 1302 Borden Street and legally described on Exhibit "A" attached hereto and incorporated herein, the SUBJECT PROPERTY"; and WHEREAS, a public hearing on said petition was held before the Planning and Zoning Commission on August 19, 2020 in the manner prescribed by ordinance and statute, and as a result of said hearing, the Planning and Zoning Commission did recommend to the City Council the granting of the requested conditional use permit; and WHEREAS, the City Council has considered the evidence and recommendations from the Planning and Zoning Commission and finds that the approval of the requested conditional use permit is consistent with the objectives of the City of McHenry Zoning Ordinance to protect the public health, safety, morals and general welfare of its residents. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF MCHENRY, MCHENRY COUNTY, ILLINOIS, AS FOLLOWS: SECTION 1: That the SUBJECT PROPERTY is hereby granted a Conditional Use Permit to allow outdoor storage in conjunction with a towing business subject to the following conditions: 1. All outdoor storage shall be screened from view by a 6-foot privacy fence, at minimum, or by a landscaped barrier that is approved by the Zoning Administrator; 2. The property owners shall maintain and replace any existing landscaped screening that is damaged or destroyed; 3. All outdoor storage shall be related to the site's existing business operations; 4. The outdoor storage area shall not be accessible to the general public; 6 Department of Community Development McHenry Municipal Center e) r 333 Green Street McHenry, Illinois 60050 Phone: (815) 363-2170 McHenr Fax: (815) 363-2173 www.cityofmchenry.orgrg 5. The outdoor storage of bulk materials is prohibited unless enclosed within a storage container; 6. The outdoor storage area shall be maintained in a neat and orderly fashion; 7. All leaking vehicles shall be stored indoors or on a paved surface; 8. All repair work shall be conducted indoors; 9. All other federal, state, and local laws shall be met. SECTION 2: In granting said Conditional Use Permit, the City Council finds that the Approval Criteria for Conditional Uses listed in Section 11-15-5 of the City of McHenry Zoning Ordinance have been met: 1. Any adverse impact of types or volumes of traffic flow not otherwise typical in the zoning district has been minimized. 2. Any adverse effects of noise, glare, odor, dust, waste disposal, blockage of light or air, or other adverse environmental effects of a type or degree not characteristic of permitted uses in the zoning district, have been appropriately controlled. 3. The proposed use will fit harmoniously with the existing natural or man-made character of its surroundings, and with permitted uses in the zoning district. The use will not have undue deleterious effect on the environmental quality, property values, or neighborhood character already existing in the area or normally associated with permitted uses in the district. 4. The proposed use will not require existing community facilities or services to a degree disproportionate to that normally expected of permitted uses in the district, nor generate disproportionate demand for new services or facilities, in such a way as to place undue burdens upon existing development in the area. 5. The proposed use will not be detrimental to the safety or health of the employees, patrons, or visitors associated with the use nor of the general public in the vicinity. 6. The proposed use is in harmony with all other elements of compatibility pertinent to the Conditional Use and its particular location. SECTION 3: All Ordinances or parts thereof in conflict with the terms and provisions hereof are hereby repealed to the extent of such conflict. 7 410.111. Department of Community Development Vak McHenry Municipal Center r ift. 333 Green Street V McHenry, Illinois 60050 Phone: (815) 363-2170 815)1 MCHet www.cityofmchenry.org SECTION 4: This Ordinance shall be published in pamphlet form by and under the authority of the corporate authorities of the City of McHenry, McHenry County, Illinois. SECTION 5: This Ordinance shall be in full force and effect from and after its passage, approval, and publication in pamphlet form as provided by law. PASSED THIS DAY OF 2020 AYES: NAYS: ABSTAINED: ABSENT: NOT VOTING: APPROVED THIS DAY OF 2020 ATTEST: MAYOR CITY CLERK 8 47). Department of Community Development rMcHenry Municipal Center 333 Green Street McHenry, Illinois 60050 Phone: (815) 363-2170 363-2173 McHenr Fax: (815) www.cityofmchenry.henry.orgrg Exhibit A Legal Description of the Subject Property THAT PART OF THE SOUTHWEST QUARTER OF SECTION 26, TOWNSHIP 45 NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN, DESCRIBED AS FOLLOWS: COMMENCING AT A STAKE 2 RODS NORTH 11 DEGREES WEST FROM A STAKE IN THE CENTER OF WAUKENGAN RAOD, WHICH STAKE STANDS NORTH 74% DEGREES WEST, 8.80 CHAINS FROM THE INTERSECTION OF THE CENTER LINE OF FRONT STREET IN WEST MCHENRY WITH THE CENTER LINE OF WAUKEGAN ROAD, BEING SOUTHWESTERLY CORNER OF A TRACT OF LAND CONVEYED BY CHARLES H. PARKS AND WIFE, TO CATHERINE WIRFS BY WARRANTY DEED RECORDED. AUGUST 2, 1893 IN BOOK 89 OF DEEDS, PAGE 408, AND RUNNING THENCE NORTH 74% DEGREES WEST ALONG THE NORTHERLY LINE OF WAUKEGAN ROAD, 16.5 FEET; THENCE NORTH 12 DEGREES 0 MINUTES WEST 166.27 FEET FOR A PLACE OF BEGINNING;THENCE CONTINUING NORTH 12 DEGREES 0 MINUTES WEST, 139.94 FEET; THENCE SOUTH 74 DEGREES 15 MINUTES EAST; 16.5 FEET TO THE NORTHWESTERLY CORNER OF SAID TRACT OF LAND CONVEYED TO CATHERINE WIRFS AFORESAID; THENCE NORTH 82 DEGREES 0 MINUTES EAST, 142.60 FEET;THENCE NORTH 90 DEGREES EAST, 72.60 FEET;THENCE SOUTH 0 DEGREES EAST, 19.8 FEET;THENCE WEST 71.30 FEET;THENCE SOUTH 4 DEGREES EAST, 146.27 FEET; THENCE NORTH 88 DEGREES 14 MINUTES WEST, 140.08 FEET TO THE PLACE OF BEGINNING, IN MCHENRY COUNTY, ILLINOIS. 1 Staff Report for the City of McHenry Planning & Zoning Commission Petition: Z-972 Hearing: August 19, 2020 PIN: 09-26-351-012 Applicant: Krzysztof Lenart, 1524 River Terrace Drive, Johnsburg, IL 60051 ("Property Owner") Address: 1302 Borden Street, McHenry, IL 60050 Subject Property") Request: Request for a Conditional Use Permit to allow outdoor storage in conjunction with a towing Location: The site consists of 0.49 acres more or business. less, and is located approximately 161 feet north of the intersection of Borden Street and W. Elm Street. Aerial Jt k - 1 I III ilWe s li. A t.w n 11\ ., y w Source. Maxar, i ii ES Airhus[)S. USDA.USGS Ae r r";s i ,6o ree 04-,4. , -.x r . Y A. ''" Mile g a ` - u 0.01 0.02 Zoning & Land Use Map Current Zoning & Land Use: r C 5 Highway Commercial District Towing/Auto-Repair)111 k =z ---&--. __sa— Surrounding Zoning & Land Use: WJWest Ave-- North: I-1 Industrial I (Industrial/Allied Die Casting) Freund AI East: C-5 Highway Commercial 1 RS-4 yf (Commercial/Clean'n Shine) o ey I South: C-5 Highway Commercial 07 :' 2• (Commercial/Clean'n Shine) West: C-5 Highway Commercial Commercial/Advance Auto 1 r -mot--- - Parts) Nfax3r Geic,e. a „wail. i iS r Cci ''unit Metra-M cHeiir; rY Mile Station'. _•• , 0.05 0.1 Future Land Use MapCityofMcHenryFutureLandUseMapDesignation: Commercial Environmental Low Density Corridors Residential Water Subject Property 1 1 Future Land Use Commercial Parks and Commercial Conservation Low Density Residential Area Environmental Corridors171Medium-Density Residential kasai. allpip.',01%,,, Parks and Conservation Area Water Agricultural Institutional High-Denisty Residential Sources:Esri,HERE.Garmin, Intermap; Increment P Corp.,GESCO,USGS, FAO,NPS, Estate Residential NRCAN.GeoBase.IGN, Kadaster NL,Ordnance Other Survey,Esri Japan,MET!, Esri China(Hong Kong), c)Open teetMa D,,r., Mile S 0.05 0.1 Staff Report for the City of McHenry Planning& Zoning Commission Staff Comments The following comments and conclusions are based upon staff analysis and review prior to this hearing and are to be considered viable unless evidence is established to the contrary.Staff may have additional comments based upon the testimony presented during the public hearing. BACKGROUND&REQUEST SUMMARY The petitioner (KrzysztofLenart, DN N DRTY LLC.)is requesting approval of a Conditional Use Permit to allow outdoor storage in conjunction with a towing business on 0.49 acres,more or less, property with a common address of 1302 Borden Street.On October 15,2012, the McHenry City Council approved ORD-12-1605 which allowed the outdoor storage on the subject property.The conditions of approval were as follows: 1. The property shall be cleared of any miscellaneous debris and all overgrown vegetation be trimmed and continually maintained(immediately); 2. The building shall be painted to the extent it's visually attractive and exterior rust is removed (next 9 months following City Council approval); 3. There shall be no outdoor storage of anything other than vehicles/trailers being repaired on-site and/or awaiting repair; 4. The property shall connect to city water and sewer(1-2 months following City Council approval); 5. Outdoor storage of leaking vehicles is prohibited; 6. Outdoor storage of inoperable vehicles,as defined by city ordinances,is prohibited; 7. Outdoor storage area is limited to the east of the existing building and storage area must be secured, including some type of security control/device during non-business hours or at least minimal security lighting; 8. All repair work shall be conducted within the building; 9. Outdoor storage area shall not be accessible to the general public; 10. Installation of a minimum of 85-100%opaque, minimum six-foot fence shall be required to fully enclose/screen outdoor storage from Borden Street or alternativelysmaller sections of fencing shall be constructed along with the use of natural vegetation as specified in the staff report (1-2 months following City Council approval). Condition six specifically identifies inoperable vehicles as not permitted to be stored outdoors. The petitioners will need to have condition six removed in order to operate a towing business. CITY OF MCHENRY ORDINANCES Inoperable vehicle is defined in §5-8-2 of the Health and Sanitation Ordinance as"...all motor vehicles which, in their present state or condition, cannot be driven on a public street or highway in full compliance with all provisions of the Illinois Vehicle Code and ordinances of the City, and which have remained in such a state or condition for a period of seven (7) consecutive days. This definition DOES NOT INCLUDE A)A motor vehicle which has been rendered temporarily incapable of being drive under its own power in order to perform ordinary service or repair operations; B)Any motor vehicle that is kept within a building not in use; and C) A motor vehicle on the premises of a place of business engaged in the wrecking or junking of motor vehicles. The petitioner must meet the Approval Criteria for Conditional Uses, listed in §11-15-5 of the City of McHenry Zoning Ordinance. COMPREHENSIVE PLAN OBJECTIVES AND POLICIES Overall,staff believes the proposed development is consistent with the City's Comprehensive Plan objectives and policies. Land Use, Objective—Allow a mixture of land uses in appropriate areas to promote responsible growth while providing a high quality of life to the residents. (p. 27) o Policy— "Preserve and expand areas of commercial land use." Approval of the applicant's request would promote the preservation of existing commercial land uses by allowing commercial land use to continue. Unique Character,Objective—Promote land uses that allow the expansion of services for residents. (p. 28) o Policy — "Locate intense commercial and office uses where they will not negatively affect residential or open space uses." The proposed development is located off a state route and is not directly adjacent to other residential properties. Approval of the applicants' request will not negatively affect residential or open space uses. STAFF ASSESSMENT The former owners of the subject property received approval for the operation of an auto-repair shop with outdoor storage subject to conditions (see Background &Request Summary). The sixth condition specifies that no inoperable vehicles shall be permitted on site. The petitioner will need to receive approval of a Conditional Use Permit for outdoor storage of inoperable vehicles in conjunction with a towing business. The surrounding land use and zoning consists of industrial and commercial properties. The primary concern regarding outdoor storage is largely aesthetic and potentially environmental from leaking automobile fluids. The property currently contains what appears to be an 8ft privacy fence facing Borden Street with a 6ft privacy fence on the north side, and a chain link fence that is screened by vegetation on the east and south side. The storage area is heavily screened from view by dense vegetation to the north (see photographs). Staff believes the storage area is appropriately screened for the proposed use. The storage area is composed of gravel.Outdoor storage should be limited to non- leaking vehicles in order to not contaminate the soil. The proposed use is consistent with the future land use map recommendation for commercial.The request appears to be consistent with the City's Comprehensive Plan and approval criteria for conditional uses (see below). Staff does not object to the petitioner's request and recommends approval subject to appropriate conditions. CONDITIONAL USE APPROVAL CRITERIA A. Traffic:Any adverse impact of types or volumes of traffic flow not otherwise typical in the zoning district has been minimized. Staff does not believe a towing business of this size will generate any adverse impacts on traffic. B. Environmental Nuisance:Any adverse effects of noise,glare,odor,dust,waste disposal,blockage of light or air,or other adverse environmental effects of a type or degree not characteristic of permitted uses in the zoning district,have been appropriately controlled. Staff does not believe the proposed use will generate any adverse impact on the environment. All vehicles that may potentially leak automobile fluids should be stored on a paved surface and staff have recommended a condition to accommodate this. C. Neighborhood Character:The proposed use will fit harmoniously with the existing natural or manmade character of its surroundings,and with permitted uses in the zoning district.The use will not have undue deleterious effect on the environmental quality,property values,or neighborhood character already existing in the area or normally associated with permitted uses in the district. The surrounding land use and zoning consists of commercial and industrial. Staff believes the proposed operation is consistent with the surrounding area. D. Public Services and Facilities:The proposed use will not require existing community facilities or services to a degree disproportionate to that normally expected of permitted uses in the district,nor generate disproportionate demandfor newservices or facilities, in such a way as to place undue burdens upon existing development in the area. The site is presently serviced by City Water and Sanitary Sewer. E. Public Safety and Health:The proposed use will not be detrimentalto the safety or health ofthe employees, patrons,or visitors associated with the use norofthegeneral public in the vicinity. Staff does not believe the proposed use will have any adverse impactson public safety and health. F. Other Factors:The proposed use is in harmony with all other elements of compatibility pertinent to the conditional use and its particular location. Staff believes the proposed use is consistent with the surrounding commercial and industrial land use. PLANNING &ZONING COMMISSION MOTION lithe commission agreeswith staffs assessment, the following motion is recommended: MOTION to approve the petitioner's request for outdoor storage in conjunction with a towing business subject to the following conditions: 1. All outdoor storage shall be screened from view by a 6-foot privacy fence,at minimum,or by a landscaped barrier that is approved by the Zoning Administrator; 2. The property owners shall maintain and replace any existing landscaped screening that is damaged or destroyed; 3. All outdoor storage shall be related to the site's existing business operations; 4. The outdoor storage area shall not be accessible to the general public; 5. The outdoor storage of bulk materials is prohibited unless enclosed within a storage container; 6. The outdoor storage area shall be maintained in a neat and orderly fashion; 7. All leaking vehicles shall be stored indoorsoron a paved surface; 8. All repair work shall be conducted indoors; 9. All other federal,state,and local laws shall be met. Attachments: Petitioner'sApplication Photographs of Screening statnuram ft 1 t Beggary Roadsie )i"[ e ASS/SUM 815-91D7--8889 Conditional Use Permit Narrative: Application for a Conditional Use Permit for DN N DRTY, LLC,at the location of 1302 Borden Street McHenry,IL 60051. Our use of this property would be inside and outside storage for recreational vehicles, vehicles towed that are damaged or destroyed in a traffic accident are stored on site until picked up by the vehicle owner. The screening surrounding the building is a board on board wood fence at the front of the building and the back of building has an 8' chain link fence with trees behind the chain link fence. With the use of this property, we would be considering the following factors,to not adverse any impacts of volumes of traffic flow not otherwise typical in the zoning district. Also, would not be impacting the environment by any which way. We would be sure to keep everything up to par with the rules and regulations with the zoning district. l FORM A File Number PUBLIC HEARING APPLICATION Planning and Zoning Commission City of McHenry 333 South Green Street°McHenry,IL 60050°Tel:(815)363-2170°Fax:(815)363-2173 1. Name of Applicant kr e-ti ?40-r JP()et Tel gY)— tf 7/- /6/ Address 179 ve r 1 PCc (E' 2. Name of Property Owner Tel If other than Applicant) Address Fax 3. Name of Engineer Tel If represented) Address Fax 4. Name of Attorney Tel If represented) Address Fax 5. Common Address or Location of Property / 3(?:)Y 'f 4- 1 )W /erg I[ - ffnn'> 6. Requested Action(s)(check all that apply) Zoning Map Amendment(Rezoning)Zoning Variance-Minor XConditional Use Permit Zoning Text Amendment Zoning Variance Other Provide a brief description of the Requested Action(s). For example, the operation that requires a Conditional Use Permit,the specific Zoning Variance needed, or the new zoning classification that is requested: C i n e can pa t u - OiRt&t ete '. caste_ 1 ` 7 (A. t 1-. 61d nietf- JA f4 0/7.0 FORM A Page l of 3 7. Current Use of Property I n cpa 11 L.C-'0-07- 5t c1(« I2 C 4-( yam chic (e c 8. Current Zoning Classification of Property,Including Variances or Conditional Uses c5_ Hjhi ConkfitufaA-1 t,G6/tr e +- 9. Current Zoning Classification and,Land Use of Adjoining Properties North:s+r i South:Corn mecc-t C_ East:C`5— Cr rY\e{C la (- - West: C "C0Y\ 11' (o i L 10. Required Attachments(check all items submitted) Please refer to the Public Hearing Requirements Checklist to determine the required attachments. I. Application Fee(amount)$ ?5' O0 2. Narrative Description of Request V 3. FORM A-Public Hearing Application 4. FORM B-Zoning Map Amendment(Rezoning) Application 4 5. FORM C-Conditional Use Application 6. FORM D-Zoning Variance Application 7. FORM E-Use Variance Application 7-8. Proof of Ownership and/or Written Consent from Property Owner in the Form of an Affidavit 9. Plat of Survey with Legal Description 10. List of Owners of all Adjoining Properties 11. Public Hearing Notice 12. Sign(Provided by the City,to be posted by the Applicant) 13. Site Plan 14. Landscape Plan 15. Architectural Rendering of Building Elevations 16. Performance Standards Certification 17. Traffic Analysis 18. School Impact Analysis FORM A Page 2 of 3 I l. Disclosure of Interest The party signing the application shall be considered the Applicant. The Applicant must be the owner or trustee of record, trust beneficiary, lessee, contract purchaser, or option holder of the subject property or his or her agent or nominee. Applicant is Not Owner If the Applicant is not the owner of record of the subject property, the application shall disclose the legal capacity of the Applicant and the full name, address, and telephone number of the owner(s). In addition, an affidavit of the owners(s) shall be filed with the application stating that the Applicant has the authority from the owners(s)to make the application. Applicant or Owner is Corporation or Partnership If the Applicant, owner, contract purchaser, option holder, or any beneficiary of a land trust is a corporation or partnership, the application shall disclose the name and address of the corporation's officers, directors, and registered agents, or the partnership's general partners and those shareholders or limited partners owning in excess of five percent of the outstanding stock or interest in the corporation or interest shared by the limited partners. Applicant or Owner is a land Trust If the Applicant or owner is a land trust or other trust or trustee thereof, the full name, address, telephone number,and extent of interest of each beneficiary shall be disclosed in the application. 12. Certification T hereby certify that I am aware of all code requirements of the City of McHenry that relate to this property and that the proposed use or development described in this application shall comply with all such codes. I hereby request that a public hearing to consider this application be held before the Planning and Zoning Commission, and thereafter that a recommendation be forwarded to the City Council for the adoption of an ordinance(s) granting the requested action(s), including any modifications to this application or conditions of approval recommended by the Zoning Board of Appeals or City Council. Signature of Applicant(s) Print Name and Designation of Applicant(s) rt 0 rv/11-e o v FORM A Page 3 of 3 AFFIDAVIT OF COMPLIANCE WITH PUBLIC NOTICE REQUIREMENTS TO BE COMPLETED AFTER ALL PUBLIC HEARING REQUIREMENTS ARE FULFILLED) The undersigned, being first duly sworn, on oath deposes and states that all public notice requirements provided in the City of McHenry Zoning Ordinance have been met in connection with the current application before the City of McHenry Filed by:( Applicant's Name and Address)C7 L S7 U f J(777 30,2 &orders 7)i, lfoU(-s-7 For approval of: Requested Action) J1ine rno Applicant's Signature) k(r? /S 2 2PnarT (Applicant's Name and Address) 15-,ei-ver Terrace br; vc JO/vrlSbur }L. JOUG-1 Subscribed and sworn to before me this (0)-- day of J J 020. OFFICIAL SEAL KAMILA A LENART NOTARY PUBLIC•STATE OF LIMOS W COMASSo+ExPrommovn No ry Public PUBLIC HEARING REQUIREMENTS Page 8 REVISED 1/2/2020 FORM C File Number CONDITIONAL USE PERMIT Planning and Zoning Commission City of McHenry 333 South Green Street° McHenry. IL 60050 0 Tel: (815)363-2170 0 Fax: (815)363-2173 Table 31 of the City of McHenry Zoning Ordinance provides that in recommending approval or conditional approval of a Conditional Use Permit,the Planning and Zoning Commission shall transmit to the City Council written findings that all of the conditions listed below apply to the requested action. Please respond to each of these conditions as it relates to your request. 1. Traffic Any adverse impact of types or volumes of traffic flow not otherwise typical in the zoning district has been minimized. We are % c_n.. cmfac 1-/ 4.-rid c t ft -4-Ki Cyr'' e& 0-F 2 2. Environmental Nuisance Any adverse effects of noise, glare, odor, dust, waste disposal, blockage of light or air, or other adverse environmental effects of a type or degree not characteristic of permitted uses in the zoning district have been appropriately controlled. Fic and 4/PLw waL b1ac/ - i ateA- ' Ore(--/-J 3. Neighborhood Character The proposed use will fit harmoniously with the existing natural or man-made character of its surroundings and with permitted uses in the zoning district. The use will not have undue deleterious effect on the environmental quality, property values, or neighborhood character existing in the area or normally associated with permitted uses in the district. wze-- W LL no 1 A a ve_. ,u.-r? ote (e rims -rCTC-e m ery3 / f V' up33( bao are FORM C Page 1 of 2 4. Public Services and Facilities The proposed use will not require existing community facilities or services to a degree disproportionate to that normally expected of permitted uses in the district, nor generate disproportionate demand for new services or facilities, in such a way as to place undue burdens upon existing development in the area. I' + O(+ U Ah L lk 11 . 5. Public Safety and Health The proposed use will not be detrimental to the safety or health of the employees, patrons, or visitors associated with the use nor of the general public in the vicinity. tiokik LV91C U" /m( col y. 6. Other Factors The proposed use is in harmony with all other elements of compatibility pertinent to the Conditional Use and its particular location. LO utk kaini w H-h a C( r e (e n -i-5 o-f C'o A/y a 4-i bi 11 ' "I FORM C Page 2 of 2 V- . \ x' e A 1 A..-, . aG9 0 4. 1 P.:,' t 1. . 1..eit 1\Olt,. -7'- ,.4‘.111 b. t.. r r, WM.I iv..r-+ h.4 k. 5. mr cG, 3' 4 t. ::._ . ti Li1r R - t?d 7. I. l., ' "ate`. - R , st.ege1 sir 1.. n`t 72.80 deed rkt. v h 89°09'20"E 0 N80o j3'SO"E 4° in4 72.65'mea..,1j sego 142." C 18.a °; rINIM sd 71.22'meo. 89°20'52"W Anar 71.30'deed s 5+..1.-+Refer to ebW, ct. u. end eddrcloe ~smasha ~smashand/orpComparee11ppoal1atsbeforeu 3 dl#vr.ao.e. Mreportreaiot.tloa es to or* 4- should be b.r.on 1mpW.d D.d.r.tlon IA mods to tbe prat purch.sr sad theirer. it is not treashrreble to se2 r subsequent ons.rs. 1... w 53. O 41.a derdround tmpror.maa N ttte distance should be um:CD.Ito 2 01 it.4 r p A N A coo N totoi oft It mowtb ware.m 01_ a Z Moo b.M.. c m sub of 31:r. A co,..tr.f tv. Cif 1 earsnewt i111berW't7detu a retractook . Ili tefrrrJ.,,_.r r.retet rtpeytt point of Y ... c.,1 A. c:.;winning d 141.O7 moo. w..t,. le/wort J Ora CO N87•46'49"w e^•.. t4afrreadir 1 r40.00 744I1 t,•... dead a rIfLM 9TREFr pz. OR 10.' Survey Na09-25-351-012 Borden Stree 1 BEALrorr MULTI-BOARD RESIDENTIAL REAL ESTATE CONTRACT 7.0 1 1. THE PARTIES: Buyer and Seller are hereinafter referred to as the"Parties." 2 Buyer Name(s) [PLEASE PRINT] LENART KRZYSZTOF 3 Seller Name(s) (PLEASE PRINT] RODNEY YANEZ 4 If Dual Agency applies, check here U and complete Optional Paragraph 29. 5 2. THE REAL ESTATE: Real Estate is defined as the property,all improvements,the fixtures and Personal Proper 6 included therein. Seller agrees to convey to Buyer or to Buyer's designated grantee, the Real Estate wi 7 approximate lot size or acreage of per survey commonly known as: 8 1302 Borden Street McHenry IL 60050 McHenry 9 Address Units(lf applicable) City State Zip County 10 Permanent Index Number(s): TBD Single Family Attached Single Family Detached O Multi-Ur 11 If Designated Parking is Included: # of space(s) identified as space(s) # location 12 [CHECK TYPE] O deeded space,PIN: O limited common element O assigned space. 13 If Designated Storage is Included: #of space(s) identified as space(s) # location 14 (CHECK TYPE] deeded space, PIN: limited common element assigned space. 15 3. FIXTURES AND PERSONAL PROPERTY AT NO ADDED VALUE: All of the fixtures and included Personal Proper 16 are owned by Seller and to Seller's knowledge are in operating condition on Date of Acceptance, unless otherwi 17 stated herein. Seller agrees to transfer to Buyer all fixtures, all heating, electrical, plumbing, and well syster. 18 together with the following items at no added value by Bill of Sale at Closing[COCK OR ENUMERATE APPLICABLE ITEMS 19 _Refrigerator Wine/Beverage Refrigerator Light Fixtures,as they exist Fireplace Gas Log(s) 20 _Oven/Range/Stove _Sump Pump(s) Built-in or attached shelving ZC Smoke Detectors 21 _Microwave Water Softener(unless rented) All Window Treatments&Hardware A.Carbon Monoxide Detectors 22 _Dishwasher Central Air Conditioning Satellite Dish Invisible Fence System,Collar&& 23 _Garbage Disposal _Central Humidifier Wall Mounted Brackets(AV/TV) _Garage Door Opener(s) 24 _Trash Compactor _Central Vac&Equipment Security System(s)(unless rented) with all Transmitters 25 _Washer All Tacked Down Carpeting Intercom System Outdoor Shed 26 _Dryer Existing Storms&Screens _Electronic or Media Air Filter(s) _Outdoor Playset(s) 27 _Attached Gas Grill _Window Air Conditioner(s) _Backup Generator System Planted Vegetation 28 _Water Heater Ceiling Fan(s) Fireplace Screens/Doors/Grates _Hardscape 29 Other Items Included at No Added Value: All personal property is sold AS-IS 30 Items Not Included: 31 Seller warrants to Buyer that all fixtures, systems and Personal Property included in this Contract shall be 32 operating condition at Possession except: Personal property is AS-IS 33 A system or item shall be deemed to be in operating condition if it performs the function for which it is intende 34 regardless of age,and does not constitute a threat to health or safety. 35 If Home Warranty applies,check here 0 and complete Optional Paragraph 32. 36 4. PURCHASE PRICE AND PAYMENT: The Purchase Price is $ 325,000.00 After the payment of Larne 37 Money as provided below,the balance of the Purchase Price, as adjusted by prorations,shall be paid at Closing 38 "Good Funds" as defined by law. 39 a) CREDIT AT CLOSING: [ff APPLICABLE] Provided Buyer's lender permits such credit to show on the fin 40 settlement statement or lender's closing disclosure, and if not,such lesser amount as the lender permits,Sell 41 agrees to credit$ 0 to Buyer at Closing to be applied to prepaid expenses,closing costs or both 42 b) EARNEST MONEY: Earnest Money of$ shall be tendered to Escrowee on or before— 43 Business Days after Date of Acceptance. Additional Earnest Money,if any,of$ N/A shall be tender( 44 by 20_.Earnest Money shall be held in trust for the mutual benefit of the Parties t 520,000 Non-ref ble option payment is to be applied towards purchase price as a credit so long as all terms of the lease and option are i II compliance. Buyer Initial Buyer Initial Seller Initial7 Seller Initial in Address:1302 Borden Street, McHenry, IL 60050 7.0 Pnn.7 nc72 45 [CHECK ONE]: Seller's Brokerage; Buyer's Brokerage; As otherwise agreed by the Parties, as"Escrowet 46 In the event the Contrad is declared null and void or is terminated,Earnest Money shall be disbtused pursuant to Paragraph 2E 47 c) BALANCE DUE AT CLOSING: The Balance Due at Closing shall be the Purchase Price, plus or min 48 prorations,less Earnest Money paid,less any credits at Closing,and shall be payable in Good Funds at Closir0daysafterexerciseofoptionbutnotlaterthanJune30,2021 49 5. CLOSING: Closing shall b ort 30 or at such time as mutually agreed by the Parties 50 writing.Closing shall take place at the escrow office of the title insurance company,its underwriter,or its issui 51 agent that will issue the Owner's Policy of Title Insurance,whichever is situated nearest the Real Estate. 52 6. POSSESSION: Unless otherwise provided in Optional Paragraph 35,Seller shall deliver possession to Buyer 53 Closing. Possession shall be deemed to have been delivered when Seller and all occupants (if any) have vacat 54 the Real Estate and delivered keys to the Real Estate to Buyer or to the office of the Seller's Brokerage. 55 7. FINANCING: [INITIAL ONLY ONE OF THE FOLLOWING SUBPARAGRAPHS a, b, or c] 56 57 (5) ; iness Days prior to the date of Closing, whichever is earlier, ("Loan Contingency Date") Buyer sh 58 provide ritten evidence from Buyer's licensed lending institution confirming that Buyer has received lo 59 approval su. • t only to"at close" conditions,matters of title,survey,and matters within Buyer's control for a lo 60 as follows: [CH ONE] fixed; U adjustable; [CHECK ONE] conventional; FHA; VA; USDA; 61 other loan for %of the Purchase Price,plus private mortgage insurance(PM 62 if required, with an inter t rate(initial rate if an adjustable rate mortgage used)not to exceed %per annu: 63 amortized over not less than years. Buyer shall pay discount points not to exceed %of the loan amoui 64 Buyer shall pay origination fee(s , losing costs charged by lender,and title company escrow closing fees. 65 If Buyer,having applied for the loan :-cified above,is unable to provide such loan approval and serves Notice 66 Seller not later than the Loan Contingenc• •ate, this Contract shall be null and void. If Buyer is unable to provi, 67 such written evidence not later than the dat- •ecified herein or by any extension date agreed to by the Farb 68 Seller shall have the option of declaring this Con. -ct terminated by giving Notice to Buyer. If prior to the Sell 69 serving such Notice to terminate,Buyer provides wri . evidence of such loan approval,this Contract shall rema 70 in full force and effect. 71 Upon the expiration of ten (10) Business Days after Date • Acceptance, if Buyer has failed to make a lo, 72 application and pay all fees required for such application to proce-- and the appraisal to be performed,Seller sh. 73 have the option to declare this Contract terminated by giving Notice t. :uyer not later than five (5)Business Da 74 thereafter or any extension thereof agreed to by the Parties in writing. 75 A Party causing delay in the loan approval process shall not have ' . right to terminate under it 76 subparagraph. In the event neither Party elects to declare this Contract termin. ed as specified above, or 77 otherwise agreed,then this Contract shall continue in full force and effect without a loan contingencies. 78 Unless otherwise provided in Paragraph 30, this Contract is not contingent upon the e and/or closing 79 Buyer's existing real estate.Buyer shall be deemed to have satisfied the financing conditions o ..'s subparagral 80 if Buyer obtains a loan approval in accordance with the terms of this subparagraph even tho : the loan 81 conditioned on the sale and/or closing of Buyer's existing real estate. 82 If Buyer is seeking FHA,VA,or USDA financing,required amendments and disclosures shall be attached • tI 83 Contract.If VA, the Funding Fee, or if FHA, the Mortgage Insurance Premium(MIP),shall be paid by Buyer. 84 b) CASH TRANSACTION WITH NO MORTGAGE: (ALL CASH]If this selection is made,Buyer will p 85 at Closing,in the form of"Good Funds,"the Balance Due at Closing.Buyer represents to Seller,as of the Date of Off 86 that Buyer has sufficient funds available to satisfy the provisions of this subparagraph.Buyer agrees to verify the abo 87 representation upon the reasonable request of Seller and to authorize the disclosure of such financial information 88 Seller,Seller's attorney or Seller's broker that may be reasonably necessary to prove the availability of sufficient fun Buyer Initial Buyer Initial Seller Initial lift Seller Initial f Address:1302 Borden Street, McHenry, IL 60050 v7.0 Anne AC/1 89 to close.Buyer understands and agrees that, so long as Seller has fully complied with Seller's obligations under tl 90 Contract, any act or omission outside of the control of Seller, whether intentional or not, that prevents Buyer frc 91 satisfying the Balance Due at Closing, shall constitute a material breach of this Contract by Buyer. The Parties sh 92 share the title company escrow closing fee equally.Unless otherwise provided in Paragraph 30, this Contract sh 93 not be contingent upon the sale and/or dosing of Buyer's existing real estate. 94 95 in i •rm of"Good Funds,"the Balance Due at Closing.Buyer represents to Seller,as of the Date of Offer,that Buy 96 has suffici- . nds available to satisfy the provisions of this subparagraph. Buyer agrees to verify the abo 97 representation upon . - reasonable request of Seller and to authorize the disclosure of such financial information 98 Seller,Seller's attorney or Se r broker that may be reasonably necessary to prove the availability of sufficient fun 99 to close.Notwithstanding such repr- .lion,Seller agrees to reasonably and promptly cooperate with Buyer so tr 100 Buyer may apply for and obtain a mortgage . or loans including but not limited to providing access to the R( 101 Estate to satisfy Buyer's obligations to pay the Balance : - at Closing.Such cooperation shall include the performan 102 in a timely manner of all of Seller's pre-closing obligations un•- • Contract.This Contract shall NOT be continge 103 upon Buyer obtaining financing.Buyer understands and agrees that, • • • as Seller has fully complied with Selle. 104 obligations under this Contract, any act or omission outside of the control o : -r, whether intentional or not, if 105 prevents Buyer from satisfying the Balance Due at Closing shall constitute a material • : of this Contract by Buy! 106 Buyer shall pay the title company escrow closing fee if Buyer obtains a mortgage;provided • -ver,if Buyer elec 107 to close without a mortgage loan,the Parties shall share the title company escrow closing fee equally.U . otherwi 108 provided in Paragraph 30, this Contract shall not be contingent upon the sale and/or closing of Buyer's e 109 real estate. Commercial property,disclosures not provided and sale is AS-IS 110 8. STATUTORY DISCLOSURES:If applicable,prior to signing this Contract,Buyer: 111 [CHECK ONE]0 has ill has not received a completed Illinois Residential Real Property Disclosure; 112 [CHECK ONE]0 has I has not received the EPA Pamphlet, "Protect Your Family From Lead In Your Home;" 113 [CHECK ONE]0 has I has not received a Lead-Based Paint Disclosure; 114 [CHECK ONE] 0 has il has not received the IEMA, "Radon Testing Guidelines for Real Estate Transactions;" 115 [CHECK ONE] has I has not received the Disclosure of Information on Radon Hazards. 116 9. PRORATIONS: The requirements contained in this paragraph shall survive the Closing. Proratable items shs 117 be prorated to and including the Date of Closing and shall include without limitation, general real estate tax( 118 rents and deposits(if any)from tenants;Special Service Area or Special Assessment Area tax for the year of Closii 119 only; utilities, water and sewer, pre-purchased fuel; and Homeowner or Condominium Association fees (ar 120 Master/Umbrella Association fees, if applicable). Accumulated reserves of a Homeowner/Condominiu 121 Association(s) are not a proratable item. 122 a) The general real estate taxes shall be prorated to and including the date of Closing based on 105 % 123 the most recent ascertainable full year tax bill.All general real estate tax prorations shall be final as of Closin 124 except as provided in Paragraph 23. If the amount of the most recent ascertainable full year tax bill reflects 125 homeowner, senior citizen, disabled veteran or other exemption, a senior freeze or senior deferral,then Sell 126 has submitted or will submit in a timely manner all necessary documentation to the appropriate government 127 entity,before or after Closing, to preserve said exemption(s). The proration shall not include exemptions 128 which the Seller is not lawfully entitled. 129 b) Seller represents, if applicable, that as of Date of Acceptance Homeowner/Condominium Association( 130 fees are$ N/A per N/A (and, if applicable, Master/Umbrella Association fees are 131 $ N/A per N/A ).Seller agrees to pay prior to or at Closing the remaining balance of ar 132 special assessments by the Association(s) confirmed prior to Date of Acceptance. Buyer Initial Buyer Initial Seller Initial Seller Initial/Ay Address: 1302 Borden Street, McHenry, IL 60050 Pnna 4 nF 7 Z 133 c) Special Asse)sment Area or Special Service Area installments due after the year of Closing shall not 134 proratable items and shall be paid by Buyer, unless otherwise provided by ordinance or statute. 135 . • - 136 Part- , • Notice,may: 137 a) Appro• ' Contract; or 138 b) Disapprove -• tract, which disapproval shall not be based solely upon the Purchase Price;or 139 c) Propose modifications t .-' Contract,except for the Purchase Price,which proposal shall be conclusive 140 deemed a counteroffer notwithstan. .-: any language contained in any such proposal purporting to state t 141 proposal is not a counteroffer. If after exp• . ;en of ten (10) Business Days after Date of Acceptance writt, 142 agreement has not been reached by the Parties wi — •ect to resolution of all proposed modifications,eith 143 Party may terminate this Contract by serving Notice, whe eon this Contract shall be immediately deem( 144 terminated;or 145 d) Offer proposals specifically referring to this subparagraph d)which sh- . •it be considered a counteroffc 146 Any proposal not specifically referencing this subparagraph d) shall be • •••d made pursuant 147 subparagraph c) as a modification. If proposals made with specific reference to this subp.. - !raph d) are n 148 agreed upon, neither Buyer nor Seller may declare this contract null and void, and this contract - rema 149 in full force and effect. 150 151 provisions of thispars= ."• ----. •• .a__d waived by the Parties and this Contract shall remain in full for 152 and effect. If Notice of termination is given, sai• term . . . • • . •solute and the Contract rendered nt 153 and void upon the giving of Notice,notwithstanding any language proffered by any • • - -• • •.• ._ to •era 154 unilateral reinstatement by withdrawal of any proposal(s). 155 11. WAIVER OF PROFESSIONAL INSPECTIONS: [INITIAL IF APPLICABLE] Buyer acknowledg 156 the right to conduct inspections of the Real Estate and hereby waives the right to conduct any such inspections 157 the Real Estate,and further agrees that the provisions of Paragraph 12 shall not apply. 158 159 Buyer • conduct at Buyer's expense(unless payment for such expense is otherwise required by government 160 regulation) . er all of the following inspections of the Real Estate by one or more licensed or certified inspectic 161 services: home, ra• • environmental, lead-based paint, lead-based paint hazards or wood-destroying inst 162 infestation, or any other in .-- tions desired by Buyer in the exercise of reasonable due diligence. Seller agrees 163 make all areas of the Real Estate a • sible for inspection(s)upon reasonable notice and to have all utilities turn( 164 on during the time of such inspections. : er shall indemnify Seller and hold Seller harmless from and agair 165 any loss or damage caused by any acts of Buye . . y person performing any inspection on behalf of Buyer. 166 a) The request for repairs shall cover only the mat. .mponents of the Real Estate,limited to central heath 167 and cooling system(s), plumbing and well system, elec. - system, roof, walls, windows, doors, ceilirq 168 floors, appliances and foundation. A major component shall •- •-•med to be in operating condition, at 169 therefore not defective within the meaning of this paragraph,if it does • onstitute a current threat to heal 170 or safety,and performs the function for which it is intended,regardless of age • - it is near or at the end of 171 useful life. Minor repairs, routine maintenance items and painting, decorating or o• - items of a cosmel 172 nature,no matter the cost to remedy same,do not constitute defects,are not a part of this con . ;•ncy and shy 173 not be a basis for the Buyer to cancel this Contract. A request by Buyer for credits or repairs in . •lion 174 the tt rms of des subparagrarr Mit attaw5elier to (aware uus-Lonttact terminated and cfuect me re ,. 175 Buyer Initial Buyer Initial Seller Initial /17'Seller Initial,/° HAddress:1302 Borden Street, McHenry, IL 60050 fi7.0 Ana..GnF13 176 177 ' ,.ection for which Buyer requests resolution by Seller within five(5) Business Days (ten(10) calendar di 178 for . lead-based paint or lead-based paint hazard inspection) after Date of Acceptance. Buyer shall not . • 179 any p•rtion of the inspection report with the Notice provided under this subparagraph unle•. su 180 inspecti s report, or any part thereof, is specifically requested in writing by Seller or Seller's . orney. 181 after expir. :on of ten (10) Business Days after Date of Acceptance written agreement has not be-• reached 182 the Parties respect to resolution of all inspection issues, either Party may terminate ..s Contract 183 serving Notice t. the other Party, whereupon this Contract shall be immediately deemed te.. ' ated. 184 c) Notwithstand' anything to the contrary set forth above in this paragraph, in the ent the inspecti 185 reveals that the cond 'on of the Real Estate is unacceptable to Buyer and Buyer serve _ otice to Seller witi 186 five (5) Business Days . er Date of Acceptance, this Contract shall be null and v s . Said Notice shall r 187 include any portion of the '. spection reports unless requested by Seller. 188 d) Failure of Buyer to cond. t said inspection(s) and notify Seller within t, • time specified operates a, 189 waiver of Buyer's rights to to •nate this Contract under this Paragraph and this Contract shall rema 190 in full force and effect. 191 13. HOMEOWNER INSURANCE: This Con•act is contingent upon Buyer •staining evidence of insurability for 192 Insurance Service Organization HO-3 or es 'valent policy at standar, premium rates within ten (10) Busine 193 Days after Date of Acceptance.If Buyer is una• e to obtain evidence .f insurability and serves Notice with pro 194 of same to Seller within the time specified, thi ontract shall b null and void.If Notice is not served with 195 the time specified, Buyer shall be deemed to hay. waived t contingency and this Contract shall remain 196 full force and effect. 197 14. FLOOD INSURANCE: Buyer shall have the option to •eclare this Contract null and void if the Real Estate 198 located in a special flood hazard area. If Notice of th: op in to declare contract null and void is not given 199 Seller within ten (10) Business Days after Date of • cceptan • or by the Loan Contingency Date,whichever 200 later,Buyer shall be deemed to have waived su option and •: Contract shall remain in full force and effe 201 Nothing herein shall be deemed to affect any '; is afforded by th- 'esidential Real Property Disclosure Act. 202 15. CONDOMINIUM/COMMON INTEREST • SOCIATIONS: fir APP • •BLE] The Parties agree that the ten 203 contained in this paragraph,which may . contrary to other terms of this ontract,shall supersede any conflicts 204 terms, and shall apply to property su' ect to the Illinois Condominium P •.erty Act and the Common Inter( 205 Community Association Act or oth• applicable state association law ("Gove g Law"). 206 a) Title when conveyed sha •- good and merchantable,subject to terms an. •rovisions of the Declaration 207 Condominium/Covenants, onditions and Restrictions("Declaration/CCRs") . • all amendments;public ai 208 utility easements incl ing any easements established by or implied from the Declaration/CCRs 209 amendments thereto; .arty wall rights and agreements; limitations and conditions ' . •osed by the Governi 210 Law;installments d • after the date of Closing of general assessments established pursuant • the Declaration/CO 211 b) Seller shall b• responsible for payment of all regular assessments due and levied prig to Closing and f 212 all special as :.sments confirmed prior to Date of Acceptance. 213 c) Seller s• .11 notify Buyer of any proposed special assessment or increase in any regular asses ent betwe 214 Date of r cceptance and Closing.The Parties shall have three (3) Business Days to reach agreeme t relative 215 paym•• t thereof. Absent such agreement either Party may declare the Contract null and void. 216 d) .eller shall, within ten (10) Business Days from Date of Acceptance, apply for those items of di osu 217 on sale as described in the Governing Law, and provide same in a timely manner,but no later than the 218 period provided for by law.This Contract is subject to the condition that Seller be able to procure and provi 219 to Duyci a icica3 vi waive Buyer Initial Buyer Initial Seller Initial by Seller Initial/ Address:1302 Borden Street, McHenry, IL 60050 v7.0 Ann.c,(11 220 221 additio . •ocumentation, Buyer agrees to comply with same. 222 e) In the event ••currents and information provided by Seller to Buyer disclose that the existi 223 improvements are in vio a • - of existing rules, regulations or other restrictions or that the terms a 224 conditions contained within the docu .. would unreasonably restrict Buyer's use of the Real Estate 225 would result in financial obligations unaccepta• - • :uyer in connection with owning the Real Estate, th 226 Buyer may declare this Contract null and void by giving o - • Seller within five(5)Business Days after t 227 receipt of the documents and information required by this paragra• ting those deficiencies which 2 228 unacceptable to Buyer. If Notice is not served within the time specified,Buyer s . . •- deemed to have waiv 229 this contingency, and this Contract shall remain in full force and effect. 230 f) Seller shall provide a certificate of insurance showing Buyer and Buyer's mortgagee,if any,as an . 231 16. THE DEED: Seller shall convey or cause to be conveyed to Buyer or Buyer's designated grantee good a] 232 merchantable title to the Real Estate by recordable Warranty Deed, with release of homestead rights, (or t 233 appropriate deed if title is in trust or in an estate),and with real estate transfer stamps to be paid by Seller(unle 234 otherwise designated by local ordinance). Title when conveyed will be good and merchantable, subject only I 235 covenants, conditions and restrictions of record and building lines and easements, if any, provided they do n 236 interfere with the current use and enjoyment of the Real Estate; and general real estate taxes not due and payal 237 at the time of Closing. 238 17. MUNICIPAL ORDINANCE,TRANSFER TAX, AND GOVERNMENTAL COMPLIANCE: 239 a) The Parties are cautioned that the Real Estate may be situated in a municipality that has adopted a pt 240 closing inspection or disclosure requirement, municipal Transfer Tax or other similar ordinances. Cost 241 transfer taxes,inspection fees,and any repairs required by an inspection pursuant to municipal ordinance shu 242 be paid by the Party designated in such ordinance unless otherwise agreed to by the Parties. 243 b) The Parties agree to comply with the reporting requirements of the applicable sections of the Intern 244 Revenue Code, the Foreign Investment in Real Property Tax Act (FIRPTA), and the Real Estate Settleme 245 Procedures Act of 1974, as amended. 246 18. TITLE: At Seller's expense, Seller will deliver or cause to be delivered to Buyer or Buyer's attorney with 247 customary time limitations and sufficiently in advance of Closing, as evidence of title in Seller or Grantor, a fit 248 commitment for an ALTA title insurance policy in the amount of the Purchase Price with extended coverage by 249 title company licensed to operate in the State of Illinois, issued on or subsequent to Date of Acceptance, subje 250 only to items listed in Paragraph 16 and shall cause a title policy to be issued with an effective date as of Closin 251 The requirement to provide extended coverage shall not apply if the Real Estate is vacant land. The commitme 252 for title insurance furnished by Seller will be presumptive evidence of good and merchantable title as there: 253 shown, subject only to the exceptions therein stated. If the title commitment discloses any unpermitte 254 exceptions or if the Plat of Survey shows any encroachments or other survey matters that are not acceptable I 255 Buyer, then Seller shall have said exceptions, survey matters or encroachments removed, or have the tit 256 insurer commit to either insure against loss or damage that may result from such exceptions or survey matte: 257 or insure against any court-ordered removal of the encroachments.If Seller fails to have such exceptions waive 258 or insured over prior to Closing,Buyer may elect to take title as it then is with the right to deduct from the Purcha! 259 Price prior encumbrances of a definite or ascertainable amount.Seller shall furnish to Buyer at Closing an Affidav 260 of Title covering the date of Closing, and shall sign any other customary forms required for issuance of an ALT 261 Insurance Policy. 262 40. PLAT Of SORVCY. Nut lt5D the cprm (1) PA:Mintsa Day pi ivi to CltJ irir, a..cucpi wig+ f}a a al tztatc 263 ier rei EP yt='o Buyer Initial Buyer Initial Seller Initialer Seller Initial Address:1302 Borden Street, McHenry, IL 60050 0 Poop of 2 265 the date o and is prepared by a professional land surveyor licensed to practice land surveying under t 266 laws of the State of Illino . lat of Survey shall show visible evidence of improvements, rights of w2 267 easements, use and measurements of all p The land surveyor shall set monuments or witness corners 268 all accessible corners of the land. All such corners shall s 1 staked or flagged.The Plat of Survey sh. 269 include the following statement placed near the professional land surveyor s si ature:"This professior 270 service conforms to the current Illinois Minimum Standards for a boundary survey." A ection, 271 defined, is not a boundary survey and is not acceptable. 272 20. DAMAGE TO REAL ESTATE OR CONDEMNATION PRIOR TO CLOSING:If prior to delivery of the deed the RE 273 Estate shall be destroyed or materially damaged by fire or other casualty, or the Real Estate is taken 1 274 condemnation, then Buyer shall have the option of either terminating this Contract (and receiving a refund 275 Earnest Money) or accepting the Real Estate as damaged or destroyed, together with the proceeds of ti 276 condemnation award or any insurance payable as a result of the destruction or damage, which gross procee. 277 Seller agrees to assign to Buyer and deliver to Buyer at Closing. Seller shall not be obligated to repair or repla 278 damaged improvements.The provisions of the Uniform Vendor and Purchaser Risk Act of the State of Illinois sh 279 be applicable to this Contract, except as modified by this paragraph. 280 281 All refuse an that is not to be conveyed to Buyer shall be removed from the Real Estate 282 Seller's expense prior to delivery o oss hall have the right to inspect the Real Estate, fixtures ar 283 included Personal Property prior to Possession to verify that the e vements and included Person 284 Property are in substantially the same condition as of Date of Acceptance,normal wear an e 285 286 Seller rep - - a that with respect to the Real Estate,Seller has no knowledge of,nor has Seller received any writb 287 notice from any asso -• -• or governmental entity regarding: 288 a) zoning,building, fire or • - . a code violations that have notbeen corrected; 289 b) any pending rezoning; 290 c) boundary line disputes; 291 d) any pending condemnation or Eminent Domain procee.in:, 292 e) easements or claims of easements not shown on the public records; 293 f) any hazardous waste on the Real Estate; 294 g) real estate tax exemption(s) to which Seller is not lawfully entitled; or 295 296 Seller further represents that: To the best of Seller's knowledge: 297 ILNmnrsl There CHHECK ONE] U are are not improvements to the Real Estate which are n 298 included in full in the determination of the most recent tax assessment. 299 11Nmntsl There[CHECK ONE]0 are II are not improvements to the Real Estate which are eligib 300 for the home improvement tax exemption. 301 f1Nrrursl There[CHECK ONE]0 is a is not an unconfirmed pending special assessment affectir 302 the Real Estate by any association or governmental entity payable by Buyer after the date of Closing. 303 IINmnrsl The Real Estate[CHECK ONE] 0 is I is not located within a Special Assessment Area 304 Special Service Area,payments for which will not be the obligation of Seller after the year in which the Closing occur 305 All Seller representations shall be deemed re-made as of Closing. If prior to Closing Seller becomes aware 306 matters that require modification of the representations previously made in this Paragraph 22, Seller shi Buyer Initial Buyer Initial Seller Innitial01 Seller Initial OAddress: 1302 Borden Street, McHenry, IL 6005 Pnov7nf11 307 promptly notify Buyer. If the matters specified in such Notice are not resolved prior to Closing, Buyer m 308 terminate this Contract by Notice to Seller and this Contract shall be null and void. 309 310 the entire rently improved, the sum of three percent (3%) of the Purchase Price shall be deposited 311 escrow with the title comp e cost of the escrow to be divided equally by Buyer and Seller and paid 312 Closing.When the exact amount of the taxes rated under this Contract can be ascertained, the taxes sh. 313 be prorated by Seller's attorney at the request of either Party alle 's share of such tax liability after proratii 314 shall be paid to Buyer from the escrow funds and the balance, if any, shal e eller. If Seller's obligati( 315 after such proration exceeds the amount of the escrow funds, Seller agrees to pay such exc tl up( 316 demand. 317 24. BUSINESS DAYS/HOURS: Business Days are defined as Monday through Friday, excluding Federal holida3 318 Business Hours are defined as 8 a.m. to 6 p.m. Chicago time. In the event the Closing or Loan Contingency Dz 319 described in this Contract does not fall on a Business Day,such date shall be the next Business Day. 320 25. ELECTRONIC OR DIGITAL SIGNATURES: Facsimile or digital signatures shall be sufficient for purposes 321 executing, negotiating, finalizing, and amending this Contract, and delivery thereof by one of the follows 322 methods shall be deemed delivery of this Contract containing original signature(s). An acceptable facsim: 323 signature may be produced by scanning an original,hand-signed document and transmitting same by electror 324 means. An acceptable digital signature may be produced by use of a qualified, established electronic securi 325 procedure mutually agreed upon by the Parties. Transmissions of a digitally signed copy hereof shall be by 326 established, mutually acceptable electronic method, such as creating a PDF ("Portable Document Format 327 document incorporating the digital signature and sending same by electronic mail. 328 . - - - - 329 Con - t may be terminated by either Party, the following shall be deemed incorporated: "and Earnest Mon 330 refunded . • the joint written direction by the Parties to Escrowee or upon an entry of an order by a court 331 competent juris. ••n." 332 In the event either Party • declared the Contract null and void or the transaction has failed to close as provide 333 for in this Contract and if Escr. -e has not received joint written direction by the Parties or such court order,tl 334 Escrowee may elect to proceed as fo II. . s: 335 a) Escrowee shall give written Notice t• .•e Parties as provided for in this Contract at least fourteen(14)da: 336 prior to the date of intended disbursement of ••est Money indicating the manner in which Escrowee intern 337 to disburse in the absence of any written objection. •• written objection is received by the date indicated 338 the Notice then Escrowee shall distribute the Earnest Mon- .s indicated in the written Notice to the Parti( 339 If any Party objects in writing to the intended disbursement o - • est Money then Earnest Money shall 1 340 held until receipt of joint written direction from all Parties or until receipt of an• •er of a court of competent jurisdictic 341 b) Escrowee may file a Suit for Interpleader and deposit any funds held into • - Court for distribution aft 342 resolution of the dispute between Seller and Buyer by the Court.Escrowee may retain : • the funds deposit( 343 with the Court the amount necessary to reimburse Escrowee for court costs and reasona. - attorney's fe 344 incurred due to the filing of the Interpleader.If the amount held in escrow is inadequate to reimbur scrowl 345 for the costs and attorney's fees,Buyer and Seller shall jointly and severally indemnify Escrowee for ad.I:: 346 OM 347 27. NOTICE: Except as provided in Paragraph 30 c) 2) regarding the manner of service for "kick-out" Notices, 348 Notices shall be in writing and shall be served by one Party or attorney to the other Party or attorney. Notice 349 any one of the multiple person Party shall be sufficient Notice to all.Notice shall be given in the following manner: 350 a) By personi,. elivery;or Buyer Initial r Buyer Initial Seller Initial A Seller Initial*fink_Address: 1302 Borden Street,McHenry, IL 60050 Pnno A of 1: 351 b) By mailing to the addresses recited herein on Page 13 by regular mail and by certified mail, return recei 352 requested.Except as otherwise provided herein,Notice served by certified mail shall be effective on the date of mailing; 353 c) By facsimile transmission. Notice shall be effective as of date and time of the transmission, provided that t 354 Notice transmitted shall be sent on Business Days during Business Hours.In the event Notice is transmitted durn 355 non-business hours,the effective date and time of Notice is the first hour of the next Business Day after transmission; 356 d) By e-mail transmission if an e-mail address has been furnished by the recipient Party or the recipient Part) 357 attorney to the sending Party or is shown in this Contract. Notice shall be effective as of date and time of e-rn 358 transmission,provided that,in the event e-mail Notice is transmitted during non-business hours,the effective de 359 and time of Notice is the first hour of the next Business Day after transmission.An attorney or Party may opt o 360 of future e-mail Notice by arty form of Notice provided by this Contract;or 361 e) By commercial overnight delivery (e.g., FedEx). Such Notice shall be effective on the next Business D 362 following deposit with the overnight delivery company. 363 f) If a Party fails to provide contact information herein, as required, Notice may be served upon the Part) 364 Designated Agent in any of the manners provided above. 365 g) The Party serving a Notice shall provide courtesy copies to the Parties'Designated Agents. Failure to provii 366 such courtesy copies shall not render Notice invalid. 367 28. PERFORMANCE: Time is of the essence of this Contract. In any action with respect to this Contract, the Parti 368 are free to pursue any legal remedies at law or in equity and the prevailing party in litigation shall be entitled to col 369 reasonable attorney fees and costs from the non-prevailing party as ordered by a court of competent jurisdiction. 370 371 Ibvm,u.s,' 29. CONFIRMATION OF DUAL AGENCY: The Parties confirm that they have • • ous 372 consented to LICENSEE]acting as a Dual Agent in providing broker.• services( 373 their behalf and sp-. 'cally consent to Licensee acting as a Dual Agent with regard to the transa on referred to 374 this Contract. 375 30. SAL BUYER'S REAL ESTATE: 376 a) REPRESENTATIONS ABOU . YER'S REAL ESTATE:Buyer represents to er as follows: 377 1) Buyer owns real estate(hereinafte - erred to as"Buyer's real estate" 'th the address of: 378 379 Address City State Zip 380 2) Buyer[CHECK ONE]has has not entered into . • - .ct to sell Buyer's real estate. 381 If Buyer has entered into a contract to sell Bu : s r•. estate,that contract 382 a) [CHECK ONE]is is not subject to • ortgage con..-•ency. 383 b) [CHEC(ONE] is is not subj••- o a real estate sale con•, •envy. 384 c) [CHECK ONE]is is not •lect to a real estate dosing con: :- cy. 385 3) Buyer[CHECK ONE]has not publicly listed Buyer's real estate for s• • .th a licensed real estate brok 386 and in a local multiple ' •. g service. 387 4) If Buyer's real estat- '. not publicly listed for sale with a licensed real estate broker • in a local multip 388 listing service, : - er[CHECK ONE]: 389 a) all publicly list real estate for sale with a licensed real estate broker who will places' a la 390 ultiple listing service within five(5)Business Days after Date of Acceptance. 391 FOR INFORMATION ONLY]Broker: 392 Broker's Address: Phone: 393 Buyer Initial Buyer Initial Seller Initial it/ Seller Initial 1302 Borden Street, McHenry, IL 60050 G7.0Address: Pnna 0 n!1 I 394 395 1) This Contract is contingent upon Buyer having entered into a contract for the sale of Buyer's real estate that 396 ll force and effect as of 20 . Such contract should provide for a closing dat• 397 late an the Closing Date set forth in this Contract.If Notice is served on or before the date set forth• tt 398 subp. •graph that Buyer has not procured a contract for the sale of Buyer's real estate,this Con• .ct sh 399 be null d void. If Notice that Buyer has not procured a contract for the sale of Buyer's real :- ate is n 400 served on . before the close of business on the date set forth in this subparagraph,Buyer sh . be deem, 401 to have waive• all contingencies contained in this Paragraph 30,and this Contract shall re 1, •'n in full for 402 and effect.(If • •aragraph is used,then the following paragraph must be completed.) 403 2) In the event Buyer .s entered into a contract for the sale of Buyer's real estate as set fo s in Paragraph 30 404 1) and that contract is ' full force and effect, or has entered into a contract for the .e of Buyer's real est. 405 prior to the execution o Contract, this Contract is contingent upon Buyer do g the sale of Buyer's re 406 estate on or before 20 . If Notice that Buyer has not sed the sale of Buyer's re 407 estate is served before the do • of business on the next Business Day after date set forth in the precede 408 sentence,this Contract shall be all and void.If Notice is not served as d•• 'bed in the preceding sentenc 409 Buyer shall have deemed to have • .ived all contingencies contained' 1 's Paragraph 30,and this Contra 410 shall remain in full force and effect. 411 3) If the contract for the sale of Buyer's real. ate is terminated for any -ason after the date set forth in Paragral 412 30 b) 1)(or after the date of this Contract' •o date is set forth in 'aragraph 30 b)1)),Buyer shall,within thr 413 3)Business Days of such termination,notify •-ller of said te ' ation.Unless Buyer,as part of said Noti( 414 waives all contingencies in Paragraph 30 and c• . plies wi Paragraph 30 d),this Contract shall be null al 415 void as of the date of Notice. If Notice as req . •d b 's subparagraph is not served within the tin 416 specified,Buyer shall be in default under the term . 'this Contract. 417 C) SELLER'S RIGHT TO CONTINUE TO OFFER REAL -• TE FOR SALE: During the time of this contingent 418 Seller has the right to continue to show the Real Estat• and of'. it for sale subject to the following: 419 1) If Seller accepts another bona fide offer to pur .. - the Real te while contingencies expressed in Paragaal 420 30 b) are in effect, Seller shall notify Buyer ' writing of same. :uyer shall then have hours after Sell 421 gives such Notice to waive the contingen.' s set forth in Paragrap 30 b),subject to Paragraph 30 d). 422 2) Seller's Notice to Buyer(commonly re ed to as a"kick-out" Notic- shall be in writing and shall be sere( 423 on Buyer,not Buyer's attorney or B 'er's real estate agent.Courtesy c• •ies of such"kick-out" Notice shou 424 be sent to Buyer's attorney and : .yer's real estate agent, if known. Fail .e to provide such courtesy copi 425 shall not render Notice invalid otice to any one of a multiple-person Buy- shall be sufficient Notice to 426 Buyers.Notice for the purpo • of this subparagraph only shall be served upon B er in the following manner. 427 a) By personal delivery e :ye at the time and date of personal delivery;or 428 b) By mailing to the a. • ess recited herein for Buyer by regular mail and by ce • 'ed mail. Notice shall 1 429 effective at 10 a.m. .n the morning of the second day following deposit of Notice in • e U.S.Mail;or 430 c) By commercial • -livery overnight(e.g.,FedEx).Notice shall be effective upon delive •r at 4 p.m.Chita; 431 time on the • ' delivery day following deposit with the overnight delivery company,whichever •1 occurs. 432 3) If Buyer corn• .es with the provisions of Paragraph 30 d)then this Contract shall remain in full fo e and effect. 433 4) If the con ' gencies set forth in Paragraph 30 b)are NOT waived in writing within said time peri.• by Buy( 434 this Co .act shall be null and void. 435 5) Exce• as provided in Paragraph 30 c)2)above,all Notices shall be made in the manner provided by Par- al 436 27 this Contract. 437 6) ' yer waives any ethical objection to the delivery of Notice under this paragraph by Seller's attorney or representatit Buyer Initial Buyer Initial Seller Initial 417 Seller Initial McHenry,1302 Borden Street, IL 60050 rfl.0Address: Not,71)n'11 438 CI, .WAIVER OP PEPArIPAP6C2 439 '. agraph 30 b) when Buyer has delivered written waiver and deposited with the Escrowee additional earns 440 m••ey in the amount of$in the form of a cashier's or certified check within the time spe "E 441 If Bu •r fails to deposit the additional earnest money within the time specified, the waiver shall be • •em 442 ineffe • e and this Contract shall be null and void. 443 e) BUYE- COOPERATION REQUIRED: Buyer authorizes Seller or Seller's agent to verify re. esentatio 444 contained in • agraph 30 at any time, and Buyer agrees to cooperate in providing relevant info .• .tion. 445 1. CANCELLATION OF PRIOR REAL ESTATE CONTRACT:In the event eith- arty has enter 446 into a prior real estate c. tract, this Contract shall be subject to written cancellation of the prio ontract on or befc 447 20 In the event the prior contract is not cancelled within the time . •ecified,this Contrg 448 shall be null and void. If p '•r contract is subject to Paragraph 30 contingencies, Selle s notice to the purchas 449 under the prior contract shoul• of be served until after Attorney Review and Profes '•nal Inspections provisio 450 of this Contract have expired,be• . satisfied or waived. 451 32. HOME WAR NTY:Seller shall provide at no expense to yer a Home Warranty at a cost 452 $Evidence of a fully e-paid policy shall be delivered at C .sing. 453 33. WELL OR SANITA•Y SYSTEM INSPECTIONS: Se •r shall obtain at Seller's expense a wi 454 water test stating that the well delivers not les an five(5)gallons of w. er per minute and including a bacteria ai 455 nitrate test and/or a septic report from the appli •ble County Health IP epartment, a Licensed Environmental Heal 456 Practitioner,or a licensed well and septic inspector, ..ch dated not '•re than ninety(90)days prior to Closing,state 457 that the well and water supply and the private sari . ystem ar: operating condition with no defects noted.Sell 458 shall remedy any defect or deficiency disclosed by s. . re'.rt(s) prior to Closing, provided that if the cost 459 remedying a defect or deficiency and the cost of landscap ; together exceed $3,000,and if the Parties cannot rea, 460 agreement regarding payment of such additional cost, tract may be terminated by either Party. Addition 461 testing recommended by the report shall be obtain• :t the Se.er's expense. If the report recommends additior 462 testing after Closing, the Parties shall have the op:en of establis ' g an escrow with a mutual cost allocation f 463 necessary repairs or replacements, or either P. ay terminate thi ontract prior to Closing.Seller shall deliver 464 copy of such evaluation(s)to Buyer not less th. en(10)Business Days • :or to Closing. 465 34. WOOD DESTROY! INFESTATION:Notwithstand •• the provisions of Paragraph 12,with 466 ten(10)Business Days after Date of Acce• . ce,Seller at Seller's expense shall • -liver to Buyer a written report,date 467 not more than six (6) months prior to • e Date of Closing, by a licensed inspe ' certified by the appropriate sta 468 regulatory authority in the subcate• cry of termites, stating that there is no visible -vidence of active infestation 1 469 termites or other wood destro ' g insects. Unless otherwise agreed between the •.rties, if the report disclos 470 evidence of active infestation o tructural damage,Buyer has the option within five(5)B• iness Days of receipt of tl 471 report to proceed with the p •chase or to declare this Contract null and void. 472 35. • •SSESSION AFTER CLOSING: Possession shall be delivered no later an 11:59 p.m. on tl 473 date that is[CHECK 0 • 0 days after the date of Closing or U 20 ("th. ossession Date' 474 Seller shall be res•• ible for all utilities, contents and liability insurance, and home maintenan•• expenses un 475 delivery of •. ...- on.Seller shall deposit in escrow at Closing with an escrowee as agreed,the sum of$ 476 (if left blank, o percent(2%)of the Purchase Price)and disbursed as follows: 477 a) The -urn of$ per day for use and occupancy from and including the day after osing 478 and ' cluding the day of delivery of Possession if on or before the Possession Date; 480 Buyer Initial Buyer Initial Seller Initial Ail Seller Initial Address:1302 Borden Street, McHenry, IL 60050 0 Pao,11of7a 481 482 483 d 484 36. "AS IS"CONDITION:This Contract is for the sale and purchase of the Real Estate in its"As 485 condition as of the Date of Offer.Buyer acknowledges that no representations,warranties or guarantees with resp, 486 to the condition of the Real Estate have been made by Seller or Seller's Designated Agent other than those knox 487 defects, if any, disclosed by Seller. Buyer may conduct at Buyer's expense such inspections as Buyer desires. In tl 488 event,Seller shall make the Real Estate available to Buyer's inspector at reasonable times.Buyer shall indemnify Sel 489 and hold Seller harmless from and against any loss or damage caused by the acts of negligence of Buyer or any pers 490 performing any inspection.In the event the inspection reveals that the condition of the Real Estate is unacceptal: 491 to Buyer and Buyer so notifies Seller within five(5)Business Days after Date of Acceptance,this Contract shall 492 null and void.Buyer's notice SHALL NOT include a copy of the inspection report,and Buyer shall not be obligat 493 to send the inspection report to Seller absent Seller's written request for same.Failure of Buyer to notify Seller 494 to conduct said inspection operates as a waiver of Buyer's right to terminate this Contract under this paragraph a] 495 this Contract shall remain in full force and effect.Buyer acknowledges that the provisions of Paragraph 12 and t 496 warranty provisions of Paragraph 3 do not apply to this Contract.Nothing in this paragraph shall prohibit the exerci 497 of rights by Buyer in Paragraph 33,if applicable. 4813 37. S CCII 1CD PARTY APPROVAL: Th.1 CCI1l_ L6C1d uro1 l« apYwval of the Rt 499 Estate by Buyei s5pnified Faity,withal five(S)Du,ii«Days aftci Dc 500 of-Aeeepteitet..Lt the SpceificdP.rty does riot approve of the Rail Estate and Notice is given to Sel] 501 502 50 38. ATTACHMENTS:The following attachments,if any,are hereby incorporated into this Contr 504 fWx •` :YTTTLE]: 505 506 39. MI • 'NEOUS PROVISIONS: Buyer's and Selle ' .8 gations are contingent upon t 507 Parties entering into a separate writte . eement consistent wi - -rms and conditions set forth herein,and w 508 such additional tern-is as either Party may deem is, g for one or more of the following[CHECK APPLICABLE BORE 509 U Articles of Agreement for Deed sumption of . Mortgage U Commercial/Investment 510 or Purchase Money •- -••e Cooperative Apartment New Construction 511 U Short S• - U Tax-Deferred Exchange cant Land 5 = ulti-Unit(4 Units or fewer) C1 Interest Bearing Account Lease - • - Buyer Initial Buyer Initial Seller Initial Ali Seller Initial Address:1302 Borden Street, McHenry, IL 60050 513 THE PARTIES ACKNOWLEDGE THAT THIS CONTRACT SHALL BE GOVERNED BY THE LAWS OF THE STATE OF ILLINOIS AND IS SUBJECT TOT'. 514 COVENANT OF GOOD FAITH AND FAIR DEALING IMPLIED tN ALL ILLINOIS CONTRACTS. 515 THIS DOCUMENT WILL BECOME A LEGALLY BINDING CONTRACT WHEN SIGNED BY ALL PARTIES AND DELNERED TO THE PARTIES OR THEIR AGENTS. 516 THE PARTIES REPRESENT THAT THE TEXT OF THIS COPYRIGHTED FORM HAS NOT BEEN ALTERED AND IS IDENTICAL TO THE OFFICIAL MUL 517 BOARD ENTI L REAL ESTATE CONTRACT 7.0. 518 519 Date o DATE OF ACCEPTANCE 520 521 B er a e Seller '11llrtilr 522 Ai 523 Buyer Signature Seller gnature 524 LENART KRZYSZTOF RODNEY YANEZ 525 Print Buyer(s)N REQUIRED] Print Seller(s)Name(s)[REQUIRED] 526 /.Z k v- -- Cn a s s-Fre.‘ a--7 gOLi 527 Ad [REQUI D] Address[REQUIRED] 528 15 d/ 529 Ci ,State,Zip City,State,Zip[REQUIRED] 530 D v 1 q(Q Ae2 531 Phone E-mail Phone E-mail 441^, 532 FOR INFORMATION ONLY 533 N/A (NONE) N/A(NONE) 534 Buyer's Brokerage MLS#State License# Seller's Brokerage MLS# State License# 535 McHenry 536 Address City Zip Address City Zip 537 538 Buyer's Designated Agent MIS#State License# Seller's Designated Agent MLS# State License# 539 540 Phone Fax Phone Fax 541 542 E-mail E-mail 543 Neil J.Anderson, P.C. andersonlawfirm@mediacombb. 544 Buyer's Attorney E-mail Seller's Attorney E-mail 545 IL 1927 Main Street Spring Grove IL 60081 546 Address City State Zip Address City State Zip 547 815-675-6712 815-675-6659 548 Phone Fax Phone Fax 549 NONE NONE 550 Mortgage Company Phone Homeowner's/Condo Association(if any) Phone 551 NONE NONE 552 Loan Officer Phone/Fax Management Co./Other Contact Phone 553 NONE NONE 554 Loan Officer E-mail Management Co./Other Contact E-mail 555 Illinois Real Estate license law requires all offers be presented in a timely manner Buyer requests verification that this offer was presented. 556 Seller rejection:This offer was presented to Seller on 20 at : a.m./p.m.and rejected on 557 20 ,at_:_a.m./p.m. —[SELLERER INTTIAIS] 558 ©2018 Illinois Real Estate Lawyers Association.Alt rights reserved.Unauthorized duplication or alteration of this form or any portion thereofis prohibited.Official form available at 7,arq irk 559 (website of Illinois Real Estate lawyers Associati¢n).Approved by the following organizations,December 2018:Belvidere Beard of REALTORS*•Chicago Association of REALTORS'-Chicago560Association•DuPage County Bar Association•Heartland REALTOR'Organization•Grundy County Bar Association•Hometown Association ofRFALTORS'•Illinois Real Estate Lawyers Associati561IlliniValleyAssociationofREALTORS'-Kane County Bar Association•Kankakee-Iroquois-Ford County Association of REALTORS'-Mainstreet Organization of REALTORS'•McHenry County562Association•North Shore-Barrington Association of REALTORS'•North Suburban Bar Association•Northwest Suburban Bar Association•Oak Park Area Association of REALTORS' REALTC 563 Association of the Fox Valley,Inc.-Three Ritvrs Association of REALTORS Will County Bar Association• Address:1302 Borden Street, McHenry, IL 60050 v7.0 n,,,,, i q„s 11 T__.T - T 'TT 4404 7••ii • 4- 41..."-=•-'" i• - '••;,'-t"*".. -•'" ttr-,, -".. 4' sk...4 ...' •.• 1. 4"••.,i-•-", •: ' '• i -... ,l' - "":", e,,-•••11 ai V i- , 4.• 4--,46-i••'••';444,424.I 1' MN 7-•-----,----- T.44--, ',,...:,_ :,..' , : :..„,. loo... c... . 07. . . ,...., . it. . i,..,,_...,,,------ 4. S • 14 .I 4.4, if ra, 11..... -- •,. ......... ' j I--P•;'' • • ....,e.7,..'• .ov ' - '. -, .• J.,: A.,k...6....,.. 311 .. 4, ek _.. 4.• • la''', ,.,; ..$ IIM., .... 4,147."!..,•.1..'";.14...L .. .Aiti.76 t i ,., , •t, 4 -.. 4e- f --'; r:,,,t. s. r e, •. ,. ::? --....;F•.!= ''".., •.;44: "-4 ', ., r: '.••:."".*,•7•;-. r;;• . kt Y t 7 --,•'1,.4"' • 7•-.. `, .'4•••••,..'•• ' e- ',,....Alf, k • . ' 1'..,...,: i',,,. .30,4 .. • ,'‘N - g-r-,, --'4..., ' , -....1 itX ...'il _Ir.' •:.-!`-o'''. '''•:!..:'' ' . - :'"t4,. .?1.:..'''''4'.''';'' ''••,' .' t• ' vt• 0.. ,,,- - tk,.... t •...; •.• f:•'''...,...„ .. ,... , --,a-, r., 1•-•' r... 0 4e.. I '•'=•:;.• - ihitik 1 I. t 15.! k. . . 1,'4 11111111LAilly; , ) ,,. I , I 44.011r1w:'7, --•,• ••"---.-..."7--- Z. 7.•,;•.,•:-!:Vt.-' - 4 A: 4"i• -.''`,• 1-.44g4''''ts,....:-:.....4,. . t.... i -.. ff.; ..--,..;-;. ' ;„,,, . • ... ,,- : 4,. - , .1.; ,,. 4, 3a..0 I ' ' ..,••"".''• '' -'•"441•1'44,'. -• .:t,.. :. Ate* Department of Economic Development McHenry Municipal Center Vail. Arab 333 Green Street McHenry, Illinois 60050 McHenr Phone: (815) 363-2110 Fax: (815) 363-2128 rcwwr°'twc ° wrvcw www.ci.mchenry.il.us REGULAR AGENDA SUPPLEMENT TO:Mayor and City Council FROM: Douglas Martin, Director of Economic Development FOR: September 8, 2020 Regular City Council Meeting RE:Commercial Tenant Incentive Grant Application for Miller's Diner ATT: Commercial Tenant Grant Application AGENDA ITEM SUMMARY: Miller's Diner, a new business, is seeking a $10,000 grant from the Commercial Tenant Incentive Grant Application. ANALYSIS: Miller's Diner is opening at 3918 Main Street. They are seeking a $10,000 grant to pay for a new sign, awning and equipment. They have submitted prior year's tax returns from an existing restaurant (similar) as well as costs they have put into this restaurant to-date. The maximum grant they are eligible to receive is $10,000. If they are successful at the City Council level, staff will draft an agreement both parties will sign. RECOMMENATION: If the City Council concurs, it is recommended to direct staff to enter into an agreement with the owners of Miller's Diner for a Commercial Tenant Incentive Grant in an amount not-to- exceed $10,000. CITY OF MCHENRY Commercial Tenant Incentive Grant Application Please completely fill out this application and return it to the City ofMcHenry with the items listed in the checklist on page 2. Applicant Name: Q Tenant or Q Owner Phone Information 4/C /L(XC/ Mailing Address Fax 7/ 7 60 i%7&7 3W-S24/ Email Federal Tax ID# teaod ja ysQ1--Ce 7 L eA/fte-r< ol- 09334t99 Property Address for building for which grant/_ is sought: Information 394 /W s y e_7' /V[/e( iJ7(/'iy Property Identification Number(s) Phone g/S- 3g- 3c (L)- Check one: V New business occupying vacant retail space Existing retail business making improvements to my building or tenant space Description of fiu•niture,fixtures, and equipment to be utilized(or see information attached): At w -5/ i 3 0 . o a) i4/.l10 .r00i7/j ('g o)) 7 L WI-or< 2 c<o Aeel 3 i6 N• Continued on the next page CITYOF MCHENRY—Economic Development Department, 333 S Green Street,MCHENRY,IL 60050 PH 815.363.2110 or 815.363.2175—w wv.CityofMcHenry.Orq Application Checklist The following items must be submitted with the Incentive Application form (Page 1): i Completed and signed McHenry Incentive Grant Application; i Written estimates for the furniture, fixtures, and equipment to be purchased; i Written estimates for the façade or building improvements; A floor plan, illustrating the locations for the furniture, fixtures, and equipment (drawings do not have to be architectural renderings, but should be to scale so that the City can understand the scope of the proposed project); i Written description of the scope of the proposed project (letter to the Mayor and City Council); Taxable sales records and/or projections. I agree to comply with the guidelines and standards of the City of McHenry Commercial Tenant Incentive Program and I understand that this is a voluntary program, under which the City has the right to approve or deny any project or proposal or portions thereof. oApplicant(s) Signature Date :Y/ /2 2) I am the building owner and agree to the application submitted by my tenant, above, and agree to comply with the guidelines and standards of the City of McHenry Commercial Tenant Incentive Program and I understand that this is a voluntary program, under which the City has the right to approve or deny any project or proposal or portions thereof. Building Owner Signature - >11 1 („zt'( • Date Mailing Address: Email: Phone: CITY OF MCHENRY—Economic Development Department 333 S Green Street,McHenry IL 60050 PH 815.363.2110 or 815.363.2175 www.CityOfMcHenry.org Application Checklist The following items must be submitted with the Incentive Application form (Page 1): I Completed and signed McHenry Incentive Grant Application; Written estimates for the furniture, fixtures, and equipment to be purchased; I Written estimates for the facade or building improvements; A floor plan, illustrating the locations for the furniture, fixtures, and equipment (drawings do not have to be architectural renderings, but should be to scale so that the City can understand the scope of the proposed project); I Written description of the scope of the proposed project (letter to the Mayor and City Council); I Taxable sales records and/or projections. I agree to comply with the guidelines and standards of the City of McHenry Commercial Tenant Incentive Program and I understand that this is a voluntary program, under which the City has the right to approve or deny any project or proposal or portions thereof. Applicant(s) Signature Date '/ 4/ a 0 I am the building owner and agree to the application submitted by my tenant, above, and agree to comply with the guidelines and standards of the City of McHenry Commercial Tenant Incentive Program and I understand that this is a voluntary program, under which the City has the right to approve or deny any project or proposal or portions thereof. Building Owner Signature Date August 5, 2020 Mailing Address: 9212 Pine Avenue, Wonder Lake,IL 60097 Email: mainstreet3918@kmthl.comgmthl.com Phone: 847-406-9770 k t4 cam jrg' C +s ' X . pm ,.` .`- i .aa' '>.s{ ;;';• V 1. T g b.41 1* TF gS e,.f, omt; w 4: k,; row. ININII.NIMMEN t ! L 'J '— -- r_r_ - it N•sAa e.r .#kb. xkrr 11 M ` R . LL1/ `' --i1;;a_S r:;.,- i,, 4f1•t ' CtS':T_s if f.60,,, • i, rlr- tz` r =' a• 1 s L 1) i 77EL L17-,.2?/ 1 I IIM.S 17sawk s : r LI---..111:11M. 1 t4'' i gmeit _ , ...t, _,., • , t. 1, i......,_ . ii,:. ..4160, If de,"/„14;&41:4, ut 0 1 i , 'r I r 1 , I._ All 4111111 IIII1I1IIIPP I' i — f f Yr t-= 1•, auw4..+__•1li s. s i v.3 •-c4c .+f 46t''1,..»--i r.`.1',7 s L• z c.:.- Electric Sign Contract between Phone: Rainbow(815) 675-6750 2404 Spring Ridge Dr. ci • Spring Grove, IL 60081 Tits Inca And the Undersigned (Purchaser)Date:July 16, 2020 The Undersigned, Herein After Called The Purchaser, Requests RAINBOW SIGNS, Hereinafter Called The Seller, To Enter Our Order For The Following Specified Sign. Approximate Overall Size of Sign,Letters and General Description Miller's Diner 3918 Main Street McHenry, IL. Contact: Kim / Phone# (815) 388-2668 One custom internally illuminated sign display Type: Alumina pan with reverse channel halo lit letters & channel letter logo front illumination Logo: 43"I-I /Face: 3/16"Acrylic whittc witlitl`t surface custom printed & laminated graphic Logo: Trim l"Jewelite (Black) I Logo return: 3"D .063 & .080 aluminum (Black) Illumination: White LEDS & Low voltage LED power supplies Aluminum Pan backer: .080 aluminum Black 2"D Copy: Miller's Diner(M) at 16 '/"H 3"D Color: White with Halo lighting Illumination: On all white LEDS Service must be at sign location by others/Service needed (1) 20amp circuit 120Volts All signage above includes: Fabrication, installation & hookup to power at sign location Warranty (1) Year on all parts & labor Permit process by Rainbow Signs *Permit fees are charged by the City of Mchenry & billed to you on completion Terms 50% down 50% due upon day of installation Total,¢ Co (Cost** / yt^ ka " • i 3 a C RE/DEfl T C 1.1.5 W a'J E l Di 3 t-O v itir f 2. The Pwrc}wzerugretatopay$XXXXXXXXNrthesignundthepropertyhereinpurchased,t.sfollowe, YYX.XX?U(XxX (YXXXXXXXX herewith and the balance us evidenced by a promissory note of even dote herewith and Ln accordance with the terms thereat with interest at the rate ofXXXXXXX,%onunpaidbalance. And for the value received,the undersigned hereby promL:es to pay to the order of RAINBOW SIGNS,at its office In Spring Grove,IL the said principal stun of XxXXXXXXXXXXXXX,Dollars ininstullmuentstut follows' The sum ofXXXXXXXXXXXXXXXxxX_XXXXXXXXX Dollars(upon erection of Sian. The sum of__XXX] X-XEPollers on the XXXn,.y of XXXXXXX(XXX,and the sum of XXXXXXXXXXX Dollars on the.XXX XX X X X day of each month thereafter for-.X.XX-XX months and a final payment of X XX X}bell o,,XX XX}.:41)XXX X _ with interest from the data at the rate of XX X X 2C %per tnnnum on the whole amount of said principal renutirt ag from dine to time unpaid. And to score the payment of said ernount the undersigned authorized irrevocably any attorney of any Court of Record to appear for him,them or her in such cows In terra time or vacation,at any time hereafter, and confuse a Judgement without process in favor of the holder hereof,for such amount to may appear to be unpaid hereon,with coats and reasonable anorney's fees,and to waive all errors to any such proceedings and agrees that no writ of error or appeal shall be prosecuted on the Judgement entered by virtue hereof nor any bill in equity Wed to interfere in any manner with the operation of said Judgement and consents to immediate execution upon such Judgement hereby ratifying and corhirtuing all that weld attorney may do by virtue hereof. It is distinctly understood that all representations and agreements made by the Seller's officers or agents are included in this contract and tnothiny shrill be binding on the Seller except es and to the extent contained herein. This agreement is subject to the approval of the Seller and shall not be binding on the Seller until endorsed with his approval and after such endorsement cannot be countermanded by either party without the consent of the other. THE UNDER$IGNED HAS READ AND UNDERSTANDS THIS CONTRACT,WHICH COVERS THE ABOVE AA11327J MIE72]C XENCVM4Ye19ximmtoorkintzli0500WITHSIGNERECTEDONBUILDINGANDCONNEL-vcai TO APPROVED oursroE LEADS, IT DOES NOT COVER FURNISHING LAMPS,A MAST,CONVER rta-t,TIME CLOCK,REMOVAL OF OLD SIGN,BUILDINGI DEPARTMENT PERMIT OR b'k:E,REROUTING OF HIGH TENSION WIRES,PRIVATE PERMISSION OR REPAIRS TO INTERIOR OF BUILDING WHICH MAY BE CAUSED BY INSTALLATION OF SIGN UNLESS OTHERWISE SPECIFIED ABOVE. Purchaser La Indlvldutil,Partnership,Corporation X' Ii=PURCHASER I1:3 A CORPORATION,SIGNATURES OF PRESIDENT, SECRETARY AND TI-CE ORPORATION SEAL ARE REQUIRED. Witne9 set X amenPurchaser Accepted --— Date X— Aidreee __.. — .__ Telephone X To Awning Attach Files Options • What is your email to send quote? Do you prefer different different method to get it? I'll type up tonight. Price would be $828.00 and includes everything, I.e. tax and minor touch- up of frame if needed Send Discard hUp //;onnaci .fiility.dui'n'a ; silq<<'- . ;=ii>.o h.iail/eon l»s:' 8/0260, 1U: 0 AM Face1oll rop..4k44,-) Plant Based Pros Menu I t I' 1 ,' 4 1 t r i:, t i. h I1 All items ship free of charge regardless of order size. No sales taxes charged on every item we carry. A Home Commercial Equipment Refrigeration Equipment Reach-in Refrigeration Reach-in Refrigerators Migali 3 Door Reach-In Refrigerator C-3R-HC IMI elQ McAfee SECURE aeatcn Rrouuct.s... Ivigali 3 Door beach-In 'efrigeratorC-3-HC I'ittlit.://www.plantb.seciliros.cou?,'pieciuct'miciali-3-door-reach-i...ol YWCuyw IiriieiP,L`.;niig2J,:yl:cVv I wr1Qr1IEpPUaAinCJoEALwWC 8/9/20,11'37 AM Page 1 of 7 2,780.00 - $2,980.00 72 cu/ft reach-in refrigerator 3) adjustable, epoxy coated wire shelves Beautiful ergonomic construction &rounded corners Digital temperature controller and read-out Forced air refrigeration system for uniform temperatures inside interior Top mount compressor for increased airflow and efficiencies Migali Industries® Protection Plan: 1 Year Parts& Labor Warranty,5 Years Compressor Warranty Plant Based Pros is an Authorized Retailer of Migali products. Items purchased from Plant Based Pros are: Brand new and in original packaging. Covered by the full manufacturer warranty. Qualified for manufacturer service and support. Questions? Call 800-522-0517 Delivery Choose an option 1 SKU: N/A Category: Reach-in Refrigerators Tags:cETLus, Energy Star, ETL-Sanitation,Migali Pay as low as$116/mo,with Klarna. See if you're prequalified hops://www.plantbasedpros.com/Product/m,igali-3-door-reach-i...oTYWCuyw-HmgMrSmig29xykEVwffwnQgiEpPQaAmCoEALw_wcB 8/9/20,11:37 AM Page 2 of 7 Description Additional information Reviews (0) Description The Migali®C-3R reach-in refrigerator is excellent for storing all types of food in a commercial kitchen. The reach-in series is designed with a robust forced air refrigeration system for cold, uniform temperatures throughout the cabinet's interior.This model also incorporates a digital controller and temperature read-out for greater temperature control, increased energy efficiencies and top-of-the-line performance.The C-3R is equally eye catching and ergonomic, boasting a high polished stainless steel exterior and interior, rounded door edges and recessed door handles.The 72 cu/ft interior is spacious and comes standard with 9 adjustable shelves, however, an optional bun rack for 18"x 26" sheet pans or 12" by 20" hotel pans will also fit inside the interior's cavity. Exterior Width 77.8 Exterior Depth 33.2 Exterior Height 83.8 Shipping Weight 579 lbs Cubic Feet 72 Access Type Doors htlps://www.plantbasedpros.com/product/migali-3-door-reach-1...or(WCuyw-HmgMrSmig29xykEVwRwn QgiEpPQaAmCoEALwwcB 8/9/20, 11.37 AM Page 3 of 7 Doors 3 Door Style Swing Door Type Solid Shelves 9 Temperature Range Start 33° F Temperature Range End 41° F FI/P 42006 Amps 7.6 Voltage 115/60/1 Energy Consumption (Kwh/24hr) 3.57 Compressor Location Top Mounted Refrigerant 134A Eco Specs Energy Star 4.0 Plug Type Nema 5-15P Cord Length 9.5 Feet Installation Type Freestanding hops:/;www.plantbasedpros.corn/producl/migali-3-door-reach-i...oTYWCuyw-FImgMrSmiy29xyhEV4vkwnc giEpP0aAmCoEAi-w weB 8/9/20,'11:37 AM Page 4 of'7 Fresh e Arxfori SHOT I The image above may not accurately depict the product. KaTom #: 1 22-CTS1 800W • MPN: CTS-1 800W Ships Free Typically ships within 4 - 8 business days Like this product? Write a Review! Retail Price: $ 1 , 642 . 52 596 . 00 Each We're here to help'Shop Essential ReQpenirtg_S.u4phes Now' Adcraft CTS-1800W(1) Pan Portion Steamer- Countertop, 120v/1 ph r, r: r!' OT 0", a AlxJOrt J lAW I The image above may not accurately depict the product. Adcraft CTS-1800W Description The Adcraft CTS-1800W Fresh Shot sandwich steamer is designed to warm pitas and tortillas. It can also be used to retherm cold, precooked food.At the push of a button,the unit delivers a blast of steam at 212 degrees Fahrenheit.Because the steamer has a self- contained water reservoir,it does not need to be hooked up to a water line.Users must instead refill and dispose of water throughout the day. Able to withstand heavy-duty use,the Adcraft CTS-1800W countertop steamer has a rust-resistant stainless steel exterior.The top has a black powder coating that also resists corrosion and prevents chipping and peeling. Because the pan well is made of cast aluminum,it can be cleaned up quickly.Rubber feet on this steamer keep it in place,preventing it from moving around and scratching countertops. Product Details Keeps pitas,tortillas,and other breads hot and fresh Push-button operation delivers steam blast at 212 degrees F to instantly retherm precooked product that has been chilled 30-min.preheat time On/off rocker switch illuminates to show when the unit is operating Includes half-size stainless steel pan with perforations Top-loading design with a cool-touch Bakelite handle on the lid Self-contained,3-qt.water reservoir eliminates the need for a water hook-up Cast aluminum well is easy to clean Durable stainless steel exterior Black powder-coated top hops://wvw.katorn.corn/122-CTS18001N.html 8/9/20,11:32 AM Page 1 of 3 Rubber feet prevent slipping on countertops CE approved Dimensions&Utilities 16.75 in.W x 17.25 in.D x 8.5 in.H 15A,1800W 120 V/60 Hz/1 ph,4-ft.cord with a NEMA 5-15P plug We cover sandwich steamers and their features in our guide to steamers. Fresh Shot Steamer,countertop,1/2 size pan,push-button operation,top opening lid,self-contained water reservoir,30 minute preheat, black powder coated top,cast aluminum well,stainless steel exterior,120v/60/1-ph,1800 watts,15 amps,4'cord,NEMA 5-15P,CE ADCRAFT Adcraft CTS-1800W Specifications Manufacturer Adcraft Warranty 1 year parts&labor Product Type Countertop Cooking Equipment Application Portion Base Countertop Controls Manual Depth(in) 17.25 Heat Electric Height(in) 8.5 Hertz 60 No.of Compartments 1 Pan Capacity 1 Phase 1 Steam Generator Boilerless Voltage 120 Water Source Connectionless Width(in) 16.75 Product Countertop Steamers Product Countertop Steamers Weight 58.00 EDF Spec Sheet The warranty will not be honored for residential or non-commercial use of any Commercial Equipment. A Important prop 65 Information for California residents. Recently Viewed Products hops:J/www.katom.com/122-CT51800W.hunl 8/9/20,11:32 AM Page 2 of 3 g IMIONMEIMMI https://www.kalom.com/122-CTS1800W.hlml 8/9/20,11:32 AM Page 3 of 3 mum= k,Yorn iikamiam The image above may not accurately depict the product. KaTom #: 842-CST48 • MPN: CST 48-X Ships Free IN STOCK: Ships in 1 Business Day Like this product? Write a Review! Retail Price: $ 1 ,748 . 00 1 ,409 . 68 Each QTY: A • • . We're here to helei Shoe Es^ontial F evening eglies NOWT Centaur CST-48 48"Sandwich/Salad Prep Table w/ Refrigerated Base,115v The image above may not accurately depict the product. Centaur CST-48 Description lit: :il: l _ ENE2 - '( [ AR_PARTS & LABOR WARRANTY ! The Centaur CST-48 Centaur®Plus"'prep table holds 12 sixth-size,4-inch-deep pans in its top compartment(pans included).Two PVC- coated shelves in the cabinet base provide additional storage space.A crumb tray between the top compartment and base keeps food debris and liquids out of the storage area.The full-length,0.625-inch-thick cutting board on top is ideal for prepping sandwich and salad ingredients. Temperatures in the Centaur CST-48 prep table range from 34 to 38 degrees Fahrenheit and are maintained by R290 refrigerant.The bottom-mounted condenser's EZ slide-out design facilitates cleaning while its factory-mounted casters and brakes enable staff to reposition the unit.The table's solid-state thermostat control offers user-friendly programming,has self-diagnostics,and includes a digital thermostat readout. Product Details Part of the Centaur Plus series Top compartment holds 12 sixth-size,4-in.-deep pans(included with table) Unit ships with drip pan installed that limits holding capacity to 4-in.-deep pans;drip pan can be removed to accommodate 6-in.- deep pans https://www.katom.corn/842-CST48.html?gclid=CjOKCQjwvb75B...KuYkhnfluGGwnsagpmagtNK17cq_ZWpHhGo1-NcaAnlbEALw_wcB 8/9/20, 11:29 AM Page 1 of 5 Crumb tray under the top compartment keeps the cabinet debris free Full-length,0.625-in.-thick cutting board provides a prep area for sandwiches and salads 2 self-closing doors remain open past 90 degrees Bent metal handle along top of each door 2 PVC-coated shelves Corrosion-resistant aluminum and ABS plastic interior Stainless steel exterior top,front,and sides resist rust,dents,and scratches Heavy-duty aluminum exterior back Polyurethane insulation Brakes on the 2 front casters hold the unit in place ETL-Sanitation,cETLus listed Bottom-mount Refrigeration System Temperature range:34-38 degrees F Solid-state thermostat controls include self-diagnostics and user-friendly programming Digital thermostat display provides a temperature readout Uses R290 refrigerant Maintenance-accessible EZ slide-out condenser Refrigeration system operates quietly Dimensions&Utilities 48.2 in.Wx31 in.D x 43.3 in.H 4.3A,1/2HP 115 V/60 Hz/1 ph,10-ft.cord with a NEMA 5-15P plug Product Features htlps://www.lcatorn.corn/842-CST48,htmi?gelid=CjOKC.Qiwvb-ISB...KnYkhnflu66wnsagpmagtNKl7cy.ZWpHhGo1-NcaAnIbEALviv:cS 8/9/20,'i'I:?9AM Page 2 of 5 LWu_S1-.(:1.1014 :31ONAGE AI'[A Store additional Ingredients within arm's reach I'ul.Y-VINYI uli1IIN ;cIv)Al;ll Runs the length of the table for added work space 1. \. ,10Y-' .J), 41111.1.1.1.11ftwirs. .„,. 11111111II I11 L. i l Ac:K INSET HAND! I.'. Provides comfortable operation I i 114.4torril,lb DIGITAL DISPLAY Allows operator to monitor the Internal temperature at a glance SELF- (.1C)lNt; DOOlt W11 II S-IAY OPEN I EATURL Closes by Itself until opened past 90 degrees,where it stays open to facilitate Take a look at the Imp tables buyers'guide if you want to know more about these units. Centaur@ Sandwich/Salad Top Refrigerator,two-section,self-contained refrigeration,(12) 1/6 pans x 4"deep included,full length 5/8" thick poly-vinyl cutting board,(2)self-closing doors remain open past 90°,programmable digital display with self diagnostic,EZ slide out condenser,cool air Intake,stainless steel front,sides,&top,interior:white aluminum top,back,&door liner,stainless steel floor,(2)PVC coated shelves,casters(2 front brakes),R290 Hydrocarbon refrigerant,115V/60/1-ph,4.3 amps,1/2 HP,cord,NEMA 5-15P,ETL- Sanitation,cETLus baps://www.katom.corn/842-CST48.hUnl2gclid=CjOKCQjwvb758...KuYkhnf1u66wnsagpmaglNK17co ZWpHhGol-NcaAnlbEALw v,cb 8/9/20,11:29 AM Page 3 of 5 Watch a video about this product Centaur CST-48 Specifications Manufacturer Centaur Depth(in)31 Front Access Door Hertz 60 Includes Food Pan Max Pan Depth(in) 4 No.of Doors 2 Phase 1 Product Type Commercial Refrigeration Rating Good Use Sandwich/Salad Voltage 115 Warranty 2 year parts&labor/5 year compressor;1 year mobile or food truck Width(in)48 Product Prep Tables Type Standard Weight 335.00 EDF Spec Sheet 4. uTwp4 OUS Intertek The warranty will not be honored for residential or non-commercial use of any Commercial Equipment. v Important Prop 65 information for California residents. https://www.katorn.com/842-CST48.html?gelid=CjOKCQjwvb756...KuYkhnf1u66wnsagpmagtNK17cq.ZWpHhGo1-NcaAnlbEALw,wcB 8/9/20,11:29 AM Page 4 of 5 i i 731 Ridgeview Drive, McHenry 60050s x t ` Phone 815-344-5262Ki : ., ,,,,; K --:' -anapt / Kimandpattyscafe.com s Attn: Mr. Mayor Wayne Jeff City Council Finance& Personnel Committee Date: August 11,2020 Subject:Tenant Incentive Grant Application Following is the scope of the proposed project and taxable sales records and/or projections: Total Remodel (Inside)—Paid in Full to date: Equipment $40,000.00 Painting 2,600.00 Barnwood& installation $1,050.00 Electrician $375.00 Plumbing—work in progress Incidentals to date-$2,000.00 glassware,teapots,coffee cups, uniforms, etc.) Items to be allocated by Grant Awning$828.00 Building Sign $4,360,00 Equipment—see enclosed Replace(2) residential refrigerators, salad/prep station with refrigeration, bun steamer(Don's) If there is any additional information you require, please let me know. Thank you for your time and consideration. Sincerely Kim Ribar Miller's Diner f 'v Department of Economic Development McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 McHenr Phone: (815) 363-2110 Fax: (815) 363-2128 www.ci.mchenry.il.us REGULAR AGENDA SUPPLEMENT TO:Mayor and City Council FROM: Douglas Martin, Director of Economic Development FOR: September 8, 2020 Regular City Council Meeting RE:Commercial Tenant Incentive Grant Application for Pineapple X-Pressed ATT: Commercial Tenant Grant Application AGENDA ITEM SUMMARY: Pineapple X-Pressed, an existing business is seeking a $5,000 grant from the Commercial Tenant Incentive Grant Application. ANALYSIS: Pineapple X-Pressed recently opened at 1104 N Green Street in the River Place building. They are seeking a $5,000 grant to pay for blenders, a prep table, sandwich table, outdoor seating and new juices. Their goal is to create an outdoor eating space in front of their store. They have included sales tax projections through 2024. The maximum grant they are eligible to receive is $5,000. If they are successful at the City Council level, staff will draft an agreement both parties will sign. RECOMMENDATION: If the City Council concurs it is recommended to direct staff to enter into an agreement with the owners of Pineapple X-Pressed for a Commercial Tenant Incentive Grant in an amount not- to-exceed $5,000. Commercial Tenant Incentive Grant Application McHENRY AN_ MARKET PULSE() Applicant Information Tenant/Owner* Tenant Owner Name* Nancy Morales Mailing Address* Address,City,State,Zip 4910 Drive-In Lane Phone* 815240317 Fax Email* pxsmoothies@gmail.com Federal Tax ID#* 84-2790789 Property Information Address* Address for building for which grant is sought 1104 n green st Property Identification Number(s)* 101 Phone* 8152450317 U New Business occupying vacant retail space oil Existing retail business making improvements to my building or tenant space Description of furniture,fixtures,and equipment to be utilized* We need better equipment and outdoor seating. Use the upload buttons below for the following items that must be submitted with this application: Written Estimates for the furniture,fixtures and equipment to be purchased Written Estimate.docx 6.52KB Written Estimates for the facade or building improvements A floor plan,illustrating the locations for the furniture,fixtures,and equipment* drawings do not have to be architectural renderings,but should be to scale so that the City can understand the scope of the proposed project) Floor_Plan_Pineapple_Xpressed(1).sdr 110.59KB Written description of the scope of the proposed project* letter to the Mayor and City Council) Scope.docx 6.29KB Taxable sales records and/or projections* Taxable Sales.docx 461.31KB I agree to comply with the guidelines and standards of the City of McHenry Commercial Tenant Incentive Program and I understand that this is a voluntary program, under which the City has the right to approve or deny any project or proposal or portions thereof. Applicant Signature* 14,1 1/4 Date* 8/4/2020 I am the building owner and agree to the application submitted by my tenant,above, and agree to comply with the guidelines and standards of the City of McHenry Commercial Tenant Incentive Program and I understand that this is a voluntary program,under which the City has the right to approve or deny any project or proposal or portions thereof. Building Owner Signature Sign Date 8/4/2020 Mailing Address Email Phone Number FF p c 4,---,-1 -14 1st The following items must be submitted with the Incentive Application form (Page I): J Completed and signed Mclienry Incentive Grant Application; J Written estimates for the furniture, fixtures,and equipment to be purchased; i Written estimates for the facade or building improvements; J A floor plan, illustrating the locations for the furniture, fixtures,and equipment(drawings do not have to be architectural renderings,but should be to scale so that the City can understand the scope of the proposed project); J Written description of the scope of the proposed project(letter to the Mayor and City Council); J Taxable sales records and/or projections. I agree to comply with the guidelines and standards of the City of Melienry Commercial Tenant Incentive Program and I understand that this is a voluntary program, under which the City has the right to approve or deny any project or proposal or portions thereof. Applicant(s)Signature_ Date I am the building owner and agree to the application submitted by my tenant,above, and agree to comply with the guidelines and standards of the City of McHenry Commercial Tenant Incentive Program and !understand that this is a voluntary program, under which the City has the right to approve or deny any project or proposal or portions thereof. Building Owner Signature LA avAir Date 4 , ) Mailin Address: c lio ler ristriPt w.7-,- 2— Email CC- s-.7,----- i t',--,4,Y,'., ti.112-t-1-..S i '''"-'t II•-,'„,-. ,-,.-- ' I.1-71'11-'711. - 7 di:-.7,--,-.--1/4- Pineapple Xpressed Smoothies Written Estimate: 1. New Blenders $1,200 each we purchased regular blenders to get by but need the commercial ones) 2. Prep table $1,500 we purchased a used one to get by) 3. Sandwich table $2,500 4. Outdoor seating $1,500 5. New Juices $1,200 Write scope of proposed project: Dear Mayor and City Council Members, We are looking for assistance to help continue on the cafe One of our ideas to get thru covid is building an outdoor eating space that will stay even after covid. This would be a 12x12 deck in front of the cafe. Giving that downtown area a more welcoming look to customers. This project requires funding and the grant can help make this work. Thank You. Taxable Sales: We are currently finishing out the opening month. Period 1 - catering, outside events Period 2- Cafe 111 Period 1 Period 2 2021 2022 2023 2024 We have a more detailed projection scale in a business plan. With the outdoor seating we are hoping to raise sales at least 15-20 percent a year. q• i •_ _.000U[t i1 Page 1 _ . 1 14l i8 lZ4 1 f I raw l I 52 l li ' titlttlttitttll ittrift 71 tttl ttltiSfttllttlltItii tIttttl 11111111 111111t11ir Irttl Ittrlittlltrr itlTlltrirt ttl ::tailtrilrtttliittl. rttrt111 til_ 5+$ i .ZtJ• .2tt 0r. ram„ r wti_- . 4 ZQ t60 COf p Qifara,d a a a IF tit; It.1j • i n b I i I E a b a rv i 1 . A t t. _ 6 `F4' i jrp m t l 1b I a 4121.111. str I. j b l4zc .zs•ire , ..#?. i b Roper 1 j Qti-+ : e V gar at[.,.3/rIr W W. i tad u1C A 1 5' Iv b 7 r y. lir,Cotrt t ra I'>r.1 S, it• i b ' 3T b i 1r i • y i1 b 417 j gfam1 a I p.,t--- - - ia.1. 1 a ,I....,,iii 4._ ....'" R 653 Cr 6 Q S Q J lefault ' Annotati... X= 73' 2" Y= 4' 3" CJIP r f v. Department of Economic Development McH Munic 333 Greenipal StreetMcHenryenry , Illinois 60050 McHenr Phone: (815) 363-2110Center Fax: (815) 363-2128 www.ci.mchenry.il.us REGULAR AGENDA SUPPLEMENT TO:Mayor and City Council FROM: Douglas Martin, Director of Economic Development FOR: September 8, 2020 Regular City Council Meeting RE:Annexation of Unincorporated Pockets of land surrounded by City ATT: 1. Ordinances annexing five properties to City of McHenry 2. Plats of Annexation 3. Map of four proposed properties to be annexed to City AGENDA ITEM SUMMARY: At the June 15 City Council meeting the City Council discussed the annexation of the unincorporated islands surrounded by the City. These unincorporated islands can be forcibly annexed by the City of McHenry if the following conditions are met. Each is 60 acres in size or less Each is completely surrounded by the City (on all four sides) If these conditions are met the City can annex the properties to the City. The Council directed staff to begin the annexation process on these properties. Staff has selected four of the properties: 202 Barreville Road 219 Barreville Road 223 Barreville Road Property located north of River Road and south of Elm Street. Public notices have been served on the property owners and an ordinance has been published in the Northwest Herald, all in accordance with state statute. Ordinances and plats of annexation have been prepared for each property as well. r„ 11 Department of Economic Development V McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 McHenr ne: (815) 363-210 Fax: (815) 363-2128 www.ci.mchenry.il.us ANALYSIS: As previously stated these are four properties of the 23 identified for annexation. Staff is recommending the property north of River Road and south of Elm Street be rezoned, at the expense of the City, to commercial following annexation to the City. It is a commercial property and it makes sense to be rezoned from residential to commercial. Additionally, the property at 219 Barreville Road has some existing nonconformities that will annex to the City with the property. These include three horses, a front yard fence, chickens, growing of holiday trees and corn on the property. In looking at the properties impacted, staff has provided a map with acreages on each property. The 23 properties equal 191.59 acres. Approximately 49 single-family residences are impacted, primarily in the Crystal Lake Road/Cooney Heights area of the City. The only portion of roadway the City would be accepting is a section of south Ponca Street. Of this amount the following is the land allocation: 71 acres is a combination of two of the following land uses (residential, agricultural, commercial, industrial and vacant land) 72.04 acres is agricultural 47.45 acres is residential 67 acres is vacant land 31 acres is industrial RECOMMENDATION: Staff is approval of the attached Ordinances annexing the properties at 202 Barreville Road, 219 Barreville Road, 223 Barreville Road and the property located north of River Road and south of Elm Street. zr., Department of Economic Development v McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 McHenr Phone: (815) 363-2110 Fax: (815) 363-2128 ORDINANCE NO 20- AN ORDINANCE ANNEXING APPROXIMATELY 1.95 ACRES LOCATED AT 202 BARREVILLE ROAD, IN MCHENRY COUNTY ILLINOIS WHEREAS, the City of McHenry, McHenry County, Illinois, is a home rule municipality as contemplated under Article VII, Section 6, of the Constitution of the State of Illinois, and the passage of this Ordinance constitutes an exercise of the City's home rule powers and functions as granted in the Constitution of the State of Illinois; and WHEREAS, annexation of said real estate to the City is legally described on Exhibit "A" and depicted on the Plat of Annexation "Exhibit B," attached hereto and incorporated herein, the SUBJECT PROPERTY," in accordance with 65 ILCS 5/7-1-13; and WHEREAS, the SUBJECT PROPERTY IS not located within any other municipality or subject to an annexation agreement with any other municipality, and said real estate is presently contiguous to and may be annexed to the City in accordance with 65 ILCS 5/7/1-1, et seq.; and WHEREAS, the City of McHenry does not provide library or fire protection services to the SUBJECT PROPERTY, so notice to the Fire Protection District or Public Library District of the annexation of said real estate is not required; and 44/ ON Department of4— .......e.) Economic Development McHenry Municipal Center 333 Green Street McHenr McHenry, Illinois 60050 Phone: (815) 363-2110 Fax: (815) 363-2128 WHEREAS the City has determined that the annexation of said real estate is in the best interest of the City, will promote sound planning and growth of the City and otherwise enhance and promote the general welfare of the City and its residents. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF MCHENRY, MCHENRY COUNTY, ILLINOIS, AS FOLLOWS: SECTION 1: That the SUBJECT PROPERTY shall be and the same is hereby annexed to made a part of the corporate limits of the City of McHenry, including any and all portions of adjacent street, roads or highways as provided by law. SECTION 2: That the SUBJECT PROPERTY be and is hereby zoned E, Estate, in accordance with the City of McHenry Zoning Ordinance. SECTION 3: The City Clerk is hereby directed to cause a certified copy of this ordinance, together with said plat, to be recorded in the Office of the Recorder of Deeds of McHenry County, Illinois. Following the recordation of this ordinance and plat, a copy thereof shall be filed in the Office of the Clerk of McHenry County, Illinois. SECTION 4: All Ordinances or parts thereof in conflict with the terms and provisions hereof are hereby repealed to the extent of such conflict. SECTION 5: This Ordinance shall be published in pamphlet form by and under the authority of the corporate authorities of the City of McHenry, McHenry County, Illinois. 2 4... .ki Department of Economic Development McHenry Municipal Center 333 Green Street McHenr McHenry, Illinois 60050 Phone: (815) 363-2110 Fax: (815) 363-2128 SECTION 6: This Ordinance shall be in full force and effect from and after its passage, approval, and publication in pamphlet form as provided by law. VOTING AYE: VOTING NAY: ABSENT: ABSTAIN: APPROVED: MAYOR WAYNE JETT SEAL) ATTEST: CITY CLERK TRISHA RAMEL PASSED: APPROVED: 3 Department of ikim Ifter 0%Economic Development V McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 McHenr Phone: (815) 363-2110 Fax: (815) 363-2128 CERTIFICATION I, Trisha Ramel, do hereby certify that I am the duly appointed, acting and qualified clerk of the City of McHenry, McHenry County, Illinois, and that as such Clerk, I am the keeper of the records and minutes and proceedings of the Mayor and Aldermen of said City of McHenry. I do hereby further certify that at a regular meeting of the Mayor and Aldermen of the City of McHenry, held on the 8th day of September 2020, the foregoing ordinance entitled [An ordinance annexing approximately 1.95 acres)] in the City of McHenry, was duly passed by the City Council of the City of McHenry. The pamphlet form of ordinance no. including the ordinance and a cover sheet thereof, was prepared, and a copy of such ordinance was posted in the city hall, commencing on the day of 2020, and will continue for at least 10 days thereafter. Copies of such ordinance are also available for public inspection upon request in the office of the City Clerk. I do further certify that the original, of which the attached is a true and correct copy, is entrusted to me as the clerk of said city for safekeeping, and that I am the lawful custodian and keeper of the same. Given under my hand and seal this 8th day of September, 2020. Trisha Ramel, City Clerk City of McHenry McHenry County, Illinois seal) 4 k Department of Economic Development McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 McHenr Phone: (815) 363-2110 Fax: (815) 363-2128 Exhibit A Legal Description of the Subject Property PIN: 14-02-200-002 THAT PART OF THE WEST HALF OF LOT TWO (2) OF THE NORTHEAST QUARTER OF SECTION TWO 2) DESCRIBED AS FOLLOWS: BEGINNING AT THE NORTHWEST CORNER OF THE NORTHEAST QUARTER OF SECTION TWO (2), TOWNSHIP 44. NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN: THENCE SOUTH ALONG THE HALF SECTION LINE OF SECTION TWO (2) 632.72 FEET FOR A PLACE OF BEGINNING; THENCE EAST AT RIGHT ANGLES TO THE NORTH AND SOUTH HALF SECTION LINE OF SECTION TWO (2) FOR A DISTANCE OF 660 FEET TO AN IRON PIPE; THENCE SOUTH AT RIGHT ANGLES 132 FEET TO AN IRON PIPE; THENCE WEST AT RIGHT ANGLES 660 FEET TO THE CENTER LINE OF SECTION TWO; THENCE NORTH ALONG THE CENTER LINE OF SECTION TWO (2) 132 FEET TO THE PLACE OF BEGINNING. ALSO A STRIP OF LAND TWENTY (20) FEET WIDE IMMEDIATELY NORTH OF AND ADJOINING THE NORTHERLY LINE OF THE HEREINAFTER DESCRIBED PARCEL OF LAND: THAT PART OF THE WEST HALF OF LOT 2 OF THE NORTHEAST QUARTER OF SECTION 2, TOWNSHIP 44 NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN, DESCRIBED AS FOLLOWS: BEGINNING AT THE NORTHWEST CORNER OF THE NORTHEAST QUARTER OF SECTION 2, TOWNSHIP 44 NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN AND RUNNING THENCE SOUTH ALONG THE HALF SECTION LINE OF SECTION 2, 632.72 FEET FOR A PLACE OF BEGINNING;: THENCE EAST AT RIGHT ANGLES TO THE NORTH AND SOUTH HALF SECTION LINE OF SECTION 2 FOR A DISTANCE OF 660 FEET TO AN IRON PIPE; THENCE SOUTH AT RIGHT ANGLES, 132 FEET TO AN IRON PIPE; THENCE WEST AT RIGHT ANGLES, 660 FEET TO THE CENTER LINE OF SECTION 2; THENCE NORTH ALONG THE CENTER LINE OF SECTION 2, 132 FEET TO THE PLACE OF BEGINNING, IN MCHENRY COUNTY, ILLINOIS EXCEPTING THEREFROM THAT PART OF THE NORTHWEST QUARTER AND PART OF THE NORTHEAST QUARTER OF SECTION 2, TOWNSHIP 44 NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN, DESCRIBED AS FOLLOWS: COMMENCING AT THE NORTH QUARTER CORNER OF SAID SECTION 2; THENCE SOUTHERLY ALONG THE EAST LINE OF THE NORTHWEST QUARTER OF SAID SECTION 2, A DISTANCE OF 824.5 FEET FOR THE PLACE OF BEGINNING; THENCE NORTHERLY ALONG THE EAST LINE OF SAID NORTHWEST QUARTER, A DISTANCE OF 330.0 FEET; THENCE EASTERLY PARALLEL WITH THE NORTH LINE EXTENDED EASTERLY OF A PARCEL OF LAND CONVEYED BY EDWIN KNOX TO R. MILLER, A DISTANCE OF 72.0 FEET TO THE CENTER LINE OF BARREVILLE ROAD (ELGIN ROAD); THENCE SOUTHWESTERLY ALONG SAID CENTER LINE, A DISTANCE OF 330.78 FEET; THENCE WESTERLY PARALLEL WITH THE NORTH LINE 5 Department of Economic Development McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 McHenr Phone: (815) 363-2110 Fax: (815) 363-2128 EXTENDED EASTERLY OF SAID PARCEL OF LAND CONVEYED BY KNOX TO MILLER, A DISTANCE OF 56.0 FEET TO THE PLACE OF BEGINNING. CONTAINING 0.485 ACRE MORE OR LESS AND BEING SITUATED IN NUNDA TOWNSHIP, MCHENRY COUNTY, ILLINOIS. ALSO EXCEPTING THEREFROM THAT PORTION OF THE LANDS DESCRIBED ABOVE, LYING WITHIN BARREVILLE ROAD (GREEN STREET). 6 SOW NO' le al Department of Economic Development McHenry Municipal Center 333 Green Street McHenry, Illinois 60050McHenrPhone: (815) 363-2110 or T"`"O`"'V`"P, Fax: (815) 363-2128 Exhibit B Plat of Annexation for the Subject Property waa..e PINS 14-02-204002 PLAT OF ANNEXATION TO ATI,A,,.A...nr.n,..g THE CITY OF MCHENRY ItC` -1005 "` 1 7 OF PART OF THE NORTHEAST 1/4 OF SECTION 2, TOWNSHIP 44 by 0, „ "'° " ";,, °Y R- NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN, wMCHENRYCOUNTY, ILLINOIS. w e. — Killini rrE.01.11.IMy 0r,1.TO x.WR.M Pia Orr K.',/M. ITO,CO C00,11,21T1.Ar INT ITT 0,Der TV TAI Cs'sOI.ITO,.1•001.01 04.'01 Or Ift.•Ar0 A)CT..AS TUTS AO..A,Tr POPITIT OCT.Or MC TAWAS, wMMeI 01.A N3.Puv,d SOON DT PC.PM..O.n N ON.OW s In IOTA.'no N.A.a o MOTO I n MAKrdIMvIT ATI 11,,,,,AT.' I p s+^` pp OW 0, O,SI Pia°r`eiiAL. 0A MOTTO..aa•. CVO.WATS a..r 1'. nar oai.n'... AIP: i c:77f`,.r'"".o r 1.0\lF 6 1 J NTowr T.MC TSI Of AI Pt movenor TOM.SAOr0. wa v ee A_ oa , ..'..a yMmip' e; Nlm TA rwru e:o TOOT. MON•Rn""aa..vos axrn.wr..,wc..w O l IL i r lw r"'' n SATS NO CO TO.III I. 7 Department of Economic Development McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 Phone: (815) 363-2110 McHenr Fax: (815) 363-2128 ORDINANCE NO 20- AN ORDINANCE ANNEXING APPROXIMATELY 2.19 ACRES LOCATED AT 219 BARREVILLE ROAD, IN MCHENRY COUNTY ILLINOIS WHEREAS, the City of McHenry, McHenry County, Illinois, is a home rule municipality as contemplated under Article VII, Section 6, of the Constitution of the State of Illinois, and the passage of this Ordinance constitutes an exercise of the City's home rule powers and functions as granted in the Constitution of the State of Illinois; and WHEREAS, annexation of said real estate to the City is legally described on Exhibit "A" and depicted on the Plat of Annexation "Exhibit B," attached hereto and incorporated herein, the SUBJECT PROPERTY," in accordance with 65 ILCS 5/7-1-13; and WHEREAS, the SUBJECT PROPERTY IS not located within any other municipality or subject to an annexation agreement with any other municipality, and said real estate is presently contiguous to and may be annexed to the City in accordance with 65 ILCS 5/7/1-1, et seq.; and WHEREAS, the City of McHenry does not provide library or fire protection services to the SUBJECT PROPERTY, so notice to the Fire Protection District or Public Library District of the annexation of said real estate is not required; and A Department of Economic Development McHenry Municipal Center 333 Green Street McHenr McHenry, Illinois 60050 Phone: (815) 363-2110 Fax: (815) 363-2128 WHEREAS the City has determined that the annexation of said real estate is in the best interest of the City, will promote sound planning and growth of the City and otherwise enhance and promote the general welfare of the City and its residents. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF MCHENRY, MCHENRY COUNTY, ILLINOIS, AS FOLLOWS: SECTION 1: That the SUBJECT PROPERTY shall be and the same is hereby annexed to made a part of the corporate limits of the City of McHenry, including any and all portions of adjacent street, roads or highways as provided by law. SECTION 2: That the SUBJECT PROPERTY be and is hereby zoned E, Estate, in accordance with the City of McHenry Zoning Ordinance. The following existing uses on the SUBJECT PROPERTY are considered nonconforming uses in the E zoning district: 1) raising and maintaining three existing horses and various chickens, none of which will be sold; 2) the existing front yard fence; and 3) growing and selling holiday trees and corn. The nonconforming uses shall expire and abate at such time as the SUBJECT PROPERTY sold or title to the land changes. SECTION 3: The City Clerk is hereby directed to cause a certified copy of this ordinance, together with said plat, to be recorded in the Office of the Recorder of Deeds of McHenry County, Illinois. Following the recordation of this ordinance and plat, a copy thereof shall be filed in the Office of the Clerk of McHenry County, Illinois. SECTION 4: All Ordinances or parts thereof in conflict with the terms and provisions hereof are hereby repealed to the extent of such conflict. SECTION 5: This Ordinance shall be published in pamphlet form by and under the authority of the corporate authorities of the City of McHenry, McHenry County, Illinois. 2 IlA v, A Department of Economic Development4McHenryMunicipalCenter 333 Green Street McHenry, Illinois 60050 McHenr Phone: (815) 363-2110 Fax: (815) 363-2128 SECTION 6: This Ordinance shall be in full force and effect from and after its passage, approval, and publication in pamphlet form as provided by law. VOTING AYE: VOTING NAY: ABSENT: ABSTAIN: APPROVED: MAYOR WAYNE JETT SEAL) ATTEST: CITY CLERK TRISHA RAMEL PASSED: APPROVED: 3 Department of Economic Development McHenry Municipal Centerde) 333 Green Street McHenry, Illinois 60050 Mcl-Ienr Phone: (815) 363-2110 Fax: (815) 363-2128 CERTIFICATION I, Trisha Ramel, do hereby certify that I am the duly appointed, acting and qualified clerk of the City of McHenry, McHenry County, Illinois, and that as such Clerk, I am the keeper of the records and minutes and proceedings of the Mayor and Aldermen of said City of McHenry. I do hereby further certify that at a regular meeting of the Mayor and Aldermen of the City of McHenry, held on the 8th day of September 2020, the foregoing ordinance entitled [An ordinance annexing approximately 2.19 acres)] in the City of McHenry, was duly passed by the City Council of the City of McHenry. The pamphlet form of ordinance no. including the ordinance and a cover sheet thereof, was prepared, and a copy of such ordinance was posted in the city hall, commencing on the day of 2020, and will continue for at least 10 days thereafter. Copies of such ordinance are also available for public inspection upon request in the office of the City Clerk. I do further certify that the original, of which the attached is a true and correct copy, is entrusted to me as the clerk of said city for safekeeping, and that I am the lawful custodian and keeper of the same. Given under my hand and seal this 8th day of September, 2020. Trisha Ramel, City Clerk City of McHenry McHenry County, Illinois seal) 4 e.) Department of Economic Development McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 McHenr Phone: (815) 363-2110 Fax: (815) 363-2128 Exhibit A Legal Description of the Subject Property PIN: 14-02-100-044 PART OF THE NORTHWEST QUARTER OF SECTION 2, TOWNSHIP 44 NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN, DESCRIBED AS FOLLOWS: BEGINNING AT THE SOUTHEAST CORNER OF THE NORTHEAST QUARTER OF SAID NORTHWEST QUARTER; THENCE NORTHERLY ALONG THE EAST LINE OF SAID NORTHWEST QUARTER, 165.0 FEET; THENCE WESTERLY PARALLEL WITH THE SOUTH LINE OF THE NORTHEAST QUARTER OF SAID NORTHWEST QUARTER, 291.0 FEET; THENCE SOUTHERLY PARALLEL WITH THE EAST LINE OF SAID NORTHWEST QUARTER, 165.0 FEET TO THE SOUTH LINE OF THE NORTHEAST QUARTER OF SAID NORTHWEST QUARTER; THENCE EASTERLY ALONG SAID SOUTH LINE 291.0 FEET TO THE PLACE OF BEGINNING, IN MCHENRY COUNTY, ILLINOIS. ALSO PART OF THE NORTHEAST QUARTER OF SECTION 2, TOWNSHIP 44 NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN, DESCRIBED AS FOLLOWS: BEGINNING AT THE SOUTHEAST CORNER OF THE NORTHEAST QUARTER OF THE NORTHWEST QUARTER OF SAID SECTION 2; THENCE NORTHERLY ALONG THE EAST LINE OF SAID NORTHWEST QUARTER, 165.0 FEET; THENCE EASTERLY PARALLEL WITH THE SOUTH LINE OF THE NORTHEAST QUARTER OF SAID NORTHWEST QUARTER EXTENDED 39.0 FEET TO THE CENTER LINE OF A TRAVELED ROAD RUNNING NORTHERLY AND SOUTHERLY THROUGH SAID SECTION; THENCE SOUTHERLY ALONG SAID CENTER LINE 165.1 FEET TO THE SOUTH LINE EXTENDED OF THE NORTHEAST QUARTER OF SAID NORTHWEST QUARTER; THENCE WESTERLY ALONG SAID SOUTH LINE EXTENDED 31.0 FEET TO THE PLACE OF BEGINNING, IN MCHENRY COUNTY, ILLINOIS. EXCEPTING THEREFROM THAT PORTION OF THE LANDS DESCRIBED ABOVE, LYING WITHIN BARREVILLE ROAD (GREEN STREET). 5 Department of Economic Development i McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 McHenr Phone: (815) 363-2110 Fax: (815) 363-2128 6 joreb. 'moor j Department of 0" Economic Development McHenry Municipal Center 333 Green Street McHenry, Illinois 60050McHenrPhone: (815) 363-2110 NCARi Or TAM'OX RIVCR Fax: (815) 363-2128 Exhibit B Plat of Annexation for the Subject Property yC PINs.14-02-100-044 VAIKIPLAT OF ANNEXATION TO 7 THE CITY OF MCHENRY OF PART OF THE NORTHEAST 1/4 AND NORTHWEST 1/4 OF SECTION 2, TOWNSHIP 44 NORTH, RANGE 8 EAST OF THE THIRD I PRINCIPAL MERIDIAN, MCHENRY COUNTY, ILLINOIS. R.X o I/ 8 ao..., must GD. IN.laa.R... ITR.....co.• OLOw K WS MAD Rh Rns. d'w 4 ;1 LARKIN LANE . aw.am.M1 R.000, J a....Wdw«"RI,O.4 ay w ««a. m... NAP Mt V.MAO tat Of Mr «. R,....a.Ra.. . sr / 1AIMM,GAWP. manor o,. WO ..«.. far / m AISO 41 tee POS.PEP 10 Mt WON Wr VMS.S.Fel rsorocArr WAWA,er WO 4 ,c g1 w f' I.n:, . .. I«., 1. V F/ I CV I 1.02212 77/// 9 x 7 4 .....e.) Department of Economic Development McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 Phone: (815) 363-2110 jezMciteHenr Fax: (815) 363-2128 ORDINANCE NO 20- AN ORDINANCE ANNEXING APPROXIMATELY 1.10 ACRES LOCATED AT 223 BARREVILLE ROAD, IN MCHENRY COUNTY ILLINOIS WHEREAS, the City of McHenry, McHenry County, Illinois, is a home rule municipality as contemplated under Article VII, Section 6, of the Constitution of the State of Illinois, and the passage of this Ordinance constitutes an exercise of the City's home rule powers and functions as granted in the Constitution of the State of Illinois; and WHEREAS, annexation of said real estate to the City is legally described on Exhibit "A" and depicted on the Plat of Annexation "Exhibit B," attached hereto and incorporated herein, the SUBJECT PROPERTY," in accordance with 65 ILCS 5/7-1-13; and WHEREAS, the SUBJECT PROPERTY IS not located within any other municipality or subject to an annexation agreement with any other municipality, and said real estate is presently contiguous to and may be annexed to the City in accordance with 65 ILCS 5/7/1-1, et seq.; and WHEREAS, the City of McHenry does not provide library or fire protection services to the SUBJECT PROPERTY, so notice to the Fire Protection District or Public Library District of the annexation of said real estate is not required; and 4......„) Department of Economic Development A McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 McHenr Phone: (815) 363-2110 T~°••^^ Fax: (815) 363-2128 WHEREAS the City has determined that the annexation of said real estate is in the best interest of the City , will promote sound planning and growth of the City and otherwise enhance and promote the general welfare of the City and its residents. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF MCHENRY, MCHENRY COUNTY, ILLINOIS, AS FOLLOWS: SECTION 1: That the SUBJECT PROPERTY shall be and the same is hereby annexed to made a part of the corporate limits of the City of McHenry, including any and all portions of adjacent street, roads or highways as provided by law. SECTION 2: That the SUBJECT PROPERTY be and is hereby zoned E, Estate, in accordance with the City of McHenry Zoning Ordinance. SECTION 3: The City Clerk is hereby directed to cause a certified copy of this ordinance, together with said plat, to be recorded in the Office of the Recorder of Deeds of McHenry County, Illinois. Following the recordation of this ordinance and plat, a copy thereof shall be filed in the Office of the Clerk of McHenry County, Illinois. SECTION 4: All Ordinances or parts thereof in conflict with the terms and provisions hereof are hereby repealed to the extent of such conflict. SECTION 5: This Ordinance shall be published in pamphlet form by and under the authority of the corporate authorities of the City of McHenry, McHenry County, Illinois. 2 1..r.) ice Department of Economic Development 40+ McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 Mcl-Ienr Phone: (815) 363-2110 Fax: (815) 363-2128 SECTION 6: This Ordinance shall be in full force and effect from and after its passage, approval, and publication in pamphlet form as provided by law. VOTING AYE: VOTING NAY: ABSENT: ABSTAIN: APPROVED: MAYOR WAYNE JETT SEAL) ATTEST: CITY CLERK TRISHA RAMEL PASSED: APPROVED: 3 VDepartment of Economic Development4J"McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 McHenr Phone: (815) 363-2110 Fax: (815) 363-2128 CERTIFICATION I, Trisha Ramel, do hereby certify that I am the duly appointed, acting and qualified clerk of the City of McHenry, McHenry County, Illinois, and that as such Clerk, I am the keeper of the records and minutes and proceedings of the Mayor and Aldermen of said City of McHenry. I do hereby further certify that at a regular meeting of the Mayor and Aldermen of the City of McHenry, held on the 8th day of September 2020, the foregoing ordinance entitled [An ordinance annexing approximately 1.10 acres)] in the City of McHenry, was duly passed by the City Council of the City of McHenry. The pamphlet form of ordinance no. including the ordinance and a cover sheet thereof, was prepared, and a copy of such ordinance was posted in the city hall, commencing on the day of 2020, and will continue for at least 10 days thereafter. Copies of such ordinance are also available for public inspection upon request in the office of the City Clerk. I do further certify that the original, of which the attached is a true and correct copy, is entrusted to me as the clerk of said city for safekeeping, and that I am the lawful custodian and keeper of the same. Given under my hand and seal this 8th day of September, 2020. Trisha Ramel, City Clerk City of McHenry McHenry County, Illinois seal) 4 y Department of r..) Economic Development McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 McHenr Phone: (815) 363-2110 Fax: (815) 363-2128 Exhibit A Legal Description of the Subject Property PART OF THE NORTHWEST QUARTER OF SECTION 2, TOWNSHIP 44 NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN, DESCRIBED AS FOLLOWS: BEGINNING AT THE SOUTHEAST CORNER OF THE NORTHEAST QUARTER OF SAID NORTHWEST QUARTER; THENCE NORTHERLY ALONG THE EAST LINE OF SAID NORTHWEST QUARTER, 165.0 FEET; THENCE WESTERLY PARALLEL WITH THE SOUTH LINE OF THE NORTHEAST QUARTER OF SAID NORTHWEST QUARTER, 291.0 FEET; THENCE SOUTHERLY PARALLEL WITH THE EAST LINE OF SAID NORTHWEST QUARTER, 165.0 FEET TO THE SOUTH LINE OF THE NORTHEAST QUARTER OF SAID NORTHWEST QUARTER; THENCE EASTERLY ALONG SAID SOUTH LINE 291.0 FEET TO THE PLACE OF BEGINNING, IN MCHENRY COUNTY, ILLINOIS. ALSO PART OF THE NORTHEAST QUARTER OF SECTION 2, TOWNSHIP 44 NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN, DESCRIBED AS FOLLOWS: BEGINNING AT THE SOUTHEAST CORNER OF THE NORTHEAST QUARTER OF THE NORTHWEST QUARTER OF SAID SECTION 2; THENCE NORTHERLY ALONG THE EAST LINE OF SAID NORTHWEST QUARTER, 165.0 FEET; THENCE EASTERLY PARALLEL WITH THE SOUTH LINE OF THE NORTHEAST QUARTER OF SAID NORTHWEST QUARTER EXTENDED 39.0 FEET TO THE CENTER LINE OF A TRAVELED ROAD RUNNING NORTHERLY AND SOUTHERLY THROUGH SAID SECTION; THENCE SOUTHERLY ALONG SAID CENTER LINE 165.1 FEET TO THE SOUTH LINE EXTENDED OF THE NORTHEAST QUARTER OF SAID NORTHWEST QUARTER; THENCE WESTERLY ALONG SAID SOUTH LINE EXTENDED 31.0 FEET TO THE PLACE OF BEGINNING, IN MCHENRY COUNTY, ILLINOIS. EXCEPTING THEREFROM THAT PORTION OF THE LANDS DESCRIBED ABOVE, LYING WITHIN BARREVILLE ROAD (GREEN STREET). 5 40011.- 4.....„) h Department of Economicvelopment McHenry MuniDecipal Center 333 Green Street McHenry, Illinois 60050 McHenr Phone: (815) 363-2110 0""`100Y1.1 11 Fax: (815) 363-2128 Exhibit B Plat of Annexation for the Subject Property PIN..14-02-1 -O44 — igI PLAT OF ANNEXATION TO THE CITY OF MCHENRY OF PART OF THE NORTHEAST 1/4 AND NORTHWEST 1/4 OF SECTION 2. TOWNSHIP 44 NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN, MCHENRY COUNTY, ILLINOIS. y ram' Mr niMV CM/MAW D pma'ouMa6 ) I/ II j3' f h Moon 0,0.01,I si M CD iu OP' „ iA aQ..,OO aMl_. H sI' n W08*.1 _ at M/a,.ta.. !DO OOPRO/0•1140 is e° Y tl %; I LARKIN LANE Ycu OtWPMV f!lAn M M AwYxO IN 1N P1. j' Mr MO 711111CX. m...o.Nnw , MU0>..Y ARDOWNO.N. DY . 1NO Ye.gym,"' R eddy / .. 5 '` rniaT;= al. JIRO nu PO De NMI* o f i I it a ...• .n. l W 0•0111114f MVO MOW Ilarll 4' LBWS Mai ISDPORD/IADDI ID i//////i/ 77.'/J p N 6 w Department of Vik Economic Development vMcHenry Municipal Center 333 Green Street McHenry, Illinois 60050 McHenr Phone: (815) 363-2110 Fax: (815) 363-2128 ORDINANCE NO 20- AN ORDINANCE ANNEXING APPROXIMATELY .57 ACRES LOCATED NORTH OF RIVER ROAD AND SOUTH OF ILLINOIS ROUTE 120, 09-26-482-029, IN MCHENRY COUNTY ILLINOIS WHEREAS, the City of McHenry, McHenry County, Illinois, is a home rule municipality as contemplated under Article VII, Section 6, of the Constitution of the State of Illinois, and the passage of this Ordinance constitutes an exercise of the City's home rule powers and functions as granted in the Constitution of the State of Illinois; and WHEREAS, annexation of said real estate to the City is legally described on Exhibit "A" and depicted on the Plat of Annexation "Exhibit B," attached hereto and incorporated herein, the SUBJECT PROPERTY," in accordance with 65 ILCS 5/7-1-13; and WHEREAS, the SUBJECT PROPERTY IS not located within any other municipality or subject to an annexation agreement with any other municipality, and said real estate is presently contiguous to and may be annexed to the City in accordance with 65 ILCS 5/7/1-1, et seq.; and WHEREAS, the City of McHenry does not provide library or fire protection services to the SUBJECT PROPERTY, so notice to the Fire Protection District or Public Library District of the annexation of said real estate is not required; and Department of Economic Development i+ McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 McHenr Phone: (815) 363-2110 Fax: (815) 363-2128 WHEREAS the City has determined that the annexation of said real estate is in the best interest of the City, will promote sound planning and growth of the City and otherwise enhance and promote the general welfare of the City and its residents. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF MCHENRY, MCHENRY COUNTY, ILLINOIS, AS FOLLOWS: SECTION 1: Subject to the conditions stated in Section 3 below the SUBJECT PROPERTY shall be and the same is hereby annexed to made a part of the corporate limits of the City of McHenry, including any and all portions of adjacent street, roads or highways as provided by law. SECTION 2: That the SUBJECT PROPERTY be and is hereby zoned RS1-A, Medium-Low Density Single-Family Residential District, in accordance with the City of McHenry Zoning Ordinance. SECTION 3: This Ordinance is subject to the condition that the City, at its own expense, initiate reclassification of the SUBJECT PROPERTY to C-5 Highway Commercial District within 30 days of approval of this ordinance and that such reclassification be completed by December 31, 2020. In the event such reclassification is not completed by December 31, 2020, this Ordinance, without any further action by the City, shall be deemed void and the City shall determine whether the annexation process shall proceed without any conditions of zoning reclassification. SECTION 4: The City Clerk is hereby directed to cause a certified copy of this ordinance, together with said plat, to be recorded in the Office of the Recorder of Deeds of McHenry County, Illinois. Following the recordation of this ordinance and plat, a copy thereof shall be filed in the Office of the Clerk of McHenry County, Illinois. SECTION 5: All Ordinances or parts thereof in conflict with the terms and provisions hereof are hereby repealed to the extent of such conflict. SECTION 6: This Ordinance shall be published in pamphlet form by and under the authority of the corporate authorities of the City of McHenry, McHenry County, Illinois. 2 A 1..)ea' Vkak Department of Economic Development N.... ft McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 McF-Ienr Phone: (815) 363-2110 T"`• ^" Fax: (815) 363-2128 SECTION 7: This Ordinance shall be in full force and effect from and after its passage, approval, and publication in pamphlet form as provided by law. VOTING AYE: VOTING NAY: ABSENT: ABSTAIN: APPROVED: MAYOR WAYNE JETT SEAL) ATTEST: CITY CLERK TRISHA RAMEL PASSED: APPROVED: 3 Department of Economic Development McHenry Municipal Center 333 Green Street Mc-Ienr McHenry, Illinois 60050 Phone: (815) 363-2110 Fax: (815) 363-2128 CERTIFICATION I, Trisha Ramel, do hereby certify that I am the duly appointed, acting and qualified clerk of the City of McHenry, McHenry County, Illinois, and that as such Clerk, I am the keeper of the records and minutes and proceedings of the Mayor and Aldermen of said City of McHenry. I do hereby further certify that at a regular meeting of the Mayor and Aldermen of the City of McHenry, held on the 8th day of September 2020, the foregoing ordinance entitled [An ordinance annexing approximately .57 acres)] in the City of McHenry, was duly passed by the City Council of the City of McHenry. The pamphlet form of ordinance no. including the ordinance and a cover sheet thereof, was prepared, and a copy of such ordinance was posted in the city hall, commencing on the day of 2020, and will continue for at least 10 days thereafter. Copies of such ordinance are also available for public inspection upon request in the office of the City Clerk. I do further certify that the original, of which the attached is a true and correct copy, is entrusted to me as the clerk of said city for safekeeping, and that I am the lawful custodian and keeper of the same. Given under my hand and seal this 8th day of September, 2020. Trisha Ramel, City Clerk City of McHenry McHenry County, Illinois seal) 4 Department of Economic Development McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 VIc-Ienr Phone: (815) 363-2110 O•TM VOX ROMP.Fax: (815) 363-2128 Exhibit A Legal Description of the Subject Property PIN: 09-26-482-029 LOTS 11 AND 12 IN BLOCK 10 IN THE ORIGINAL PLAT OF THE VILLAGE (NOW CITY) OF MCHENRY, EAST SIDE OF THE RIVER, A SUBDIVISION OF PART OF THE SOUTHEAST QUARTER OF SECTION 26, TOWNSHIP 45 NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN, ACCORDING TO THE PLAT THEREOF RECORDED JULY 6, 1840, IN BOOK B OF DEEDS, PAGE 160, IN MCHENRY COUNTY, ILLINOIS. ALSO THAT PORTION OF CHARLES STREET, VACATED BY CITY OF MCHENRY ORDINANCE 02-1064, RECORDED AS DOCUMENT NUMBER 2002R27035, LYING SOUTHERLY OF THE EASTERLY EXTENSION OF THE NORTHERLY LINE OF LOT 12 IN BLOCK 10 IN THE ORIGINAL PLAT OF THE VILLAGE (NOW CITY) OF MCHENRY, EAST SIDE OF THE RIVER, A SUBDIVISION OF PART OF THE SOUTHEAST QUARTER OF SECTION 26, TOWNSHIP 45 NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN, ACCORDING TO THE PLAT THEREOF RECORDED JULY 6, 1840, IN BOOK B OF DEEDS, PAGE 160, IN MCHENRY COUNTY, ILLINOIS. ALSO THAT PORTION OF SOUTH STREET, VACATED PER PLAT OF VACATION RECORDED MARCH 22, 2002 AS DOCUMENT 2002R0027036, LYING EASTERLY OF THE SOUTHERLY EXTENSION OF THE WESTERLY LINE OF LOT 11 IN BLOCK 10 IN THE ORIGINAL PLAT OF THE VILLAGE (NOW CITY) OF MCHENRY, EAST SIDE OF THE RIVER, A SUBDIVISION OF PART OF THE SOUTHEAST QUARTER OF SECTION 26, TOWNSHIP 45 NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN, ACCORDING TO THE PLAT THEREOF RECORDED JULY 6, 1840, IN BOOK B OF DEEDS, PAGE 160, EXCEPTING THEREFROM THE LANDS DESCRIBED IN QUIT CLAIM DEED RECORDED DECEMBER 24, 2014 AS DOCUMENT 2014R0043757, ALL IN MCHENRY COUNTY, ILLINOIS. 5 Department of o Development McHenry Econ Municipalvel Center 333 Green StreetMcHenrymic, Illinois 60050 McHenr Phone: (815) 363-2110 or T"`"'"'°`" Fax: (815) 363-2128 Exhibit B Plat of Annexation for the Subject Property PIN:09 26 482 029 i u'e PLAT OF ANNEXATION TOth\': % THE CITY OF MCHENRY rl. OF PART OF THE SOUTHEAST 1/4 OF SECTION 28, TOWNSHIP 45 NORTH. RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN. MCHENRY COUNTY. ILLINOIS. L______L_ ::::e .. a 7111111111 ILLINOIS ROUTE m..II"I'I liiiiiiiii v i Ii a1 NM,non,. fie `` •. O. i .- , I i i1 I 1— ,2 J_i_ % s: I X//, o iJ A d r 1 I.. 6....0 8leaz rm.=0- s a!tiT. IFR c'' 111 6 I PIN:09-26-482-029 mdrume IM y', ,,,AO M PLAT OF ANNEXATION TO THE CITY OF MCHENRY E I . OF PART OF THE SOUTHEAST 1/4 OF SECTION 26, TOWNSHIP 45 NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN, MCHENRY COUNTY, ILLINOIS. NpI m aNE a.- _= c-fillIP GRAPHIC ^GALE. COON,RECORDER'S CFRRRCA7F S a n. TA TETE rr EUNMs ) ILLINOIS 1J CGUHTY Cr MCHENRY) As. RO a OTE 0 ME RECORDERS OFFICE GE WWII.COUNTY. LS. ONMERECUPo IN g DAY O 20_AT_0C100(_.At fl MCHENRY COUNTY RECORDE• CiR Ig V' w 'O ,D v° t° I 'I,c'eos ,°t- I2 92 yO,06 I' A99E03" I C w EyNSERi('S LTRnf1CA1F o0"gyp^ t,j 90 OR v S\ i s STATE OF NLNOS )6 St I ° r10° M ° u I FOAL r1FirRIPWNAV OF I ANR RJ RE ANNPCO'D TD ENE STY OF MCHENRY E 4 n^iSS COUNTY ON YONENRY) gt\ I/if MC EAST SCE OF NE RRpE,A SUBDIN90V OF PART o'MESOUTHEASTQUARTER T i g g0LIIIBLOCKIDINPEOWN.PLAT OF nic MUNE(NMI CITY)OF APPRO.)PURSUANT TO CIRCHAN. BY THE on CCUNQ Or j//////J( aOF N g Id THE STY OF AAMENRv AT NS MELTING HERD ON 200_, 0\}+- I {y r {a7 N ACCORDING TOO'THE PUTT THEREOF RECORDED AZT 8,MK N r B OFa®.c P¢ J FliV/ * p MCC N ECHE..COUNTY,KUNO. ELUDE CEDE hilhhh ALSO T19It12I9 / MAT KMRPI OF OVAR LES STREET.VACATED BY On OF ARMOIRE ORDINANCE 02-TONG i JS / Ot\ t `° .,.,..( µ U3 / N DUMMY OF PE , T NUMBER OT4%IN BLOC SOUTHERLYYINGNam.PUTYOF NE l,{ O 9 1 30 / 9 ro ®1 r !o HUAGE MOW GITY)Cr MCHENRY,EAsr sad OF me RIML A SUBDIVISION Cr PART OF ME V ptiti°?I_A92p2 E°.a aRR r >> SOUTHEAST OUARhF OF..OTTw x,TOINNSMo as Horn{RANG'B EAST OE TNr MIRO NI.J /f V ,At`i,\i0'I /C V. E u PRINCIPAL MERO1'AH ACCORDING 10 THE PEAT DOREO•RECORDED AAY S.184a N BOOT B L, r4 t'Si / ` °g.2 JR. 1° N V G SPA.104 N MCHENRY COUNTY,RUODS e 4, I A N N Ett F ALSO y° R CAN° I THAT PORTION O`SOUTH SIREFT,VACATED PER PUT Cr VACATION RECORDED A TEN 2ZQ G\` 2002 As DOC.VE 2002R002JOM,ONE EASTERLY O`-n£SOURER,E CEV ON OF RE O of, I 96 EMr UE OF Eor Ir w BLOCf to N TIE ORRiNAL MT O'•THE N![AO'Now or* P. y4 I /, {' J 9I/// Cr° CARTER OFA/GIO49:.EASTTINNM OF ME u NOPRAH aTPART ME PRIN ME CIPAL 1 P. N1gPOI L4C T.f PAYEAdAN,ACCORDING TOIO ME PLATTHETHEREOF RECORDED JULY UL OV,10-44 IN BOOK B OF OF. 04 z W A,V74-717 OELORIER N,2011 AS DQCMUNT 201AA00UT3Z.ALL N SOIONSY ESSAYS IL NMS I.7 O PIN:09-28-482-028 I PIN:0328-482-030 g g EXISTING CITY OF MCHENRY ZOMNG:C-5 EXCEPTION PER COG.201 AROMAOT5!) W E POEXISTINGCITYOFMCHENRYZONING:Cd yLEA. I-.I y U Fz FIe EON. ATE UNITS OFNECITYOFI.ICHENRY I O O Ri/„. F r--1 LAND TO BEAN..TO THE tiRJOTTEMOVExRYOSmOgO 1 TA7{FtrIrS CRT1PICA7F F IA STATE OF DLMMS) iIkELLANEWS NOTES s A s rnwrr OF"RANE) I. LAND TO BE ANNEXED TO ME OTT OFMCHENRY IS A P.M.orPE WI IS LK 041 CM LA PQR DESOROr8 SHERIFF'S DEED Di JUDICIAL SATE,REC RDED CRP,DROINOS LI MRARY; ASIN I2008DOO .T 2WBR0003720512 NAMING NORM SHORE L BERNARD A BALER,AN NBNS PROFESON.A SURVEY HERESY D4 CAPTAE,LLC AS ME GRANTEE(AANEUATRN SECLUDES LAICMM..O TMM..MAT nos PUT WAS PREPARED FROM MAPSPS PUTS AND HERESY on. souk('gy[A¢oewaCY DESCRIBED IN DOC I ENT 201.0013 52). wSINUMENTS OF REM90 FOR DE USES AND PUSS HEREIN SET FORM NORMITN map rm aseted far use se on Mnwtlm Pat S. THE EXISTING CORPORATE LAMS ANO MP'CE MCERRY EWING NP2 DATED X.21,2024 A0.AT AURORA VANE COUNTY,WNW BIB MN map 6 not to M used for aY onerruatla a e1W,B purposes AS SPIN HOED.ARE BASED LIMN DE W.A.,VE MINING MAP HR G'ED(NG ADDEPAN MET wiUot Masse!Nan a prvgr agent o1 HR Groan,Inc. OF THE CITY Q<MCHENRY A'Oroe ow.02/17/2 20 MN IS NOT a PIP of Survey No oYlmptbn•a open oasts w to naps// r1md,Mvyl owners.*use,or poeewbn as be camnrd horn NY doamrlt AW uo 22t 9ID No underground Improvements now hero boded unless Noon and noted COSTING ZOOM B'0YRMAi10W AS SHOWN HEREON,IS BASED UPON No emou bald M assumed by eoIH4 1 fl/ RA < MCHENRYT9,9 1ARD A BALER w_r . 1 OF 1Th.Puncturemap M d. MOwut a19Fd ambsesed a red colored ern and Naar elpnotun 5 9:70 R PROFESSIONALLICESSESIf/ SURVEYOR NO.3799 ... 30/2020 T/21/2020 9:5O:2A AM TIDE ,° S E J:\0020\200929\Survry\sw,\200929-Mna.0e9 I P W s:14-02-100-011 rcaree qr°' PLAT OF ANNEXATION TO 14-02-100-012 THE CITY OF MCHENRYJ,, M SIR9r OF PART OF THE NORTHEAST 1/4 AND NORTHWEST 1/4 OF I Wj _pm , SECTION 2, TOWNSHIP 44 NORTH, RANGE 8 EAST OF THE THIRD M,ro,,,, (1111=PRINCIPAL MERIDIAN, MCHENRY COUNTY, ILLINOIS. f y C.CvPIM` 2raLCPONTOrCOMMENCEMENTPARCEL3 /tn' a PIN:1 NE'M RO ONNG'.0.G-2 CITY EECLERK'SCEROFlG iE NO GIN o F I STATE O RUNGS )X1 1 COUNT'OF MLYENRY)) SS j////////////////// / / i/ APPRO.,PURSUANT TO ORDINANCE BY THE CITY COUNCIL O COUNTY RECORDERS LER7IFlCA7E THE CITY O MCHENRY AT IS MEETING HELD ON 200 2N.0') 380) STATE Cr RHINOS J yy V Coon,O MONORY)As 0 3 MLLAGE FLAPS JS<b Q Z THIS INSTRUMENT M0. WAS FILED MI RECORD M g ' 9OA.l1SP pJnaG P a I O g rv E/RCLIUM CESKE CIF MCHENRY CONTI:RUNGS ON THE N}ib Wry e,E LK0 Qa 2Q DAY(Y 20_AT O'OOOf_.K S Ai..0' S rep+°o`' a W p^'d s s=°^ PAR.I:PART OE THE NORTHWEST WARIER O SECTW 2 TOWNSMP N NORTH.RANGE 8 Q)OS OEPPy C. J p S w 2 EAST O THE M2)PRINCIPAL kl.PAN. 'GROG AS fII101m COIN EMMG AT THE WP Ge,{.P e 2,'Q' MOEN,COUNTY RECORDER C SOUTHEAST CORNER Cr THE NORTHEAST WART.O SAID NORTHWEST WARIER: MENGE O aGNE LIP p] , Q G p 2 tNORTHERLYALONGTHEEASTLINECrSAWNORTHWESTWART.IBSO FEET FOR ME PUCE GGGG MARTOF O,.PARALLEL: T THE SOU LANE O'RAL NORTHEASTWMEAWM E' F S NOROIKST E' F/QPp 3 1 tiWART..PARR FEET: THE SWmE%Y F ME WTH THE FAST UN'E O SAID NORM:ST QUARTER,1.0 FEET:: THENCE EASTQOY PARAUFL NTH THE SOUTH LNE Cr THE NORTHEAST WART.O SAID NORTHWEST WARIER,291.0 FEET TO HIE PUCE O BEGINIM P T EY RLfMG Q W IN YOIENRY COUNTY,ftLNOi I CO P 2 EAST OF PART OF THE NORTHEAST THIRD PRINCIPAL WAR or SECTIONDESCRIBEDAS 2 INNS. COAI N NOM R B QNh3 /1'1 i(I80') SOUTHEAST CORNER O THE NMTHEASI WART.O OE NORTHWEST WART.O S O yy SECTW 2 Mint NORWGBY ALONG THE EAST LNE G SRO NCR W WEST QUARTO?.1.0 yy 2 q WI FEET FOR THE PUCE O IEG:WHIM MOAT COMMA,.NORTHERLY 1 NOR SAID FAST LNG Cal / h W HMO FEETCrSAID : T EASTERLY PARALLEL WITH THE SOUTH(NE O-ION"NORT2AST QUARTER b RGAW,.NORTHERLY NB SCUMMY TRO.O/.0 SECTION.' TOM SOUTHWESTERLY THREST QUARTER EXTEMED.0 FEET TO THE CENTER LPN OF A TRAVELED rygiyP / NOOA.IPSpJa'PG C N L G SAID CENTER NNE;1662 FEET, THENCE WESTERLY vARA(IEI.Nm THE SOUTH 19E OF o- Wry p'i, .GG n ORTHEAST QUART.GW.0 NORTHWEST WARIER EXIOLIEO,J9.0 FEET TO TE PACE 2'NN ppp4.? yl I LA R KI N LANEEGRINMGNMCHERYCOUNTYLINOS04U1O0Z JTE T RO PART OPRIMP.MVO. DE NORTHWEST, OESTFIBED AS FlYE.. COMM..Al TES B U. 05a0?e' y GG 6 1- v[1" w 4NORMQUARTERCORM.O SMO SECTOR 2'MOM SOUTHERLY ALONG ME UST LNE O ZV p,P-Ga,G C THE NORTHNEST WART.O SAO SECTION 2 A DISTANCE O 98130 FEET TO ME NORTHEAST CORNER Cr A PARCEL O UNO CONVEYED BY EDWN Y.KNOY TO ROB`JRT G G 4 Pp O MILLER AND MS WEE BY DEED RECORDED MAY 21 1938 AS DDUY.T MEMBER J09008 FAR ' b} / Q H THE PACE O BEONMNG THENCE WES.LY ALONG THE NORM LINE O LAMA SO CONVEYED, F(ny0 EI A DISTANCE Cr 291.0 FEET TO ME NORTHWEST CORNER THEM.: THENCE NORTHERLY PMAUEL NM THE EAST LYE Or.0 NORTHWEST QUARTER,A DISTANCE O 1.0 FEET,1 Qy W yy1l O y TILE EASTERLY DISTANCENM ME NORM!NE O SAID PARCEL Cr NO CWl£IED BY i fi; IY a•rH K TO IML..A A/SOO SAID 291.0 FEET TO IRE UST LNE O SAID NOPMMEST WARIER;2 A DINING CORPORATE LWIITS O' THENCE SOUTHERLY ALONG SAW)EAST L.IM A DISTANCE O f810 FEET TO I E PACE O NS RE WY OF NCH., W Cc O BEGINNING M YOENRY COUNTY,BUNGS 10_2 hf'' F/s, r rvag7PARCEL4PARTCrMENORTHEASTWARIEROSECTION2.IDWNSHP N NORM RANGE B EAST O THE TRD PRINCIPAL MM.GESABBED AS FCLOWS COMMENCING AT THE PONTT O WOWING N, I——1 LANDS 10 BE ANHEIED ID)HE Zj I"N NORTHMARTEN COWER O SAID ENOUGH 2 THENCE SOUTHERLY ALONG ME EAST LINE O i(= L J CITY O MCHENRY WN--r W W THE NORTHWEST QUARTER O SAID SECTION 2 A DISTANCE O 98930 FEET TD ME O D4}7 HORTHUST CORNER O A PARCEL O LAM OYNK]ED BY BMW Y.K11GK TO ROBERT G aV P 2 D•'j MILLER AM MS WEE BY DEED RECORDED MAY PI 193E AS DOCUMENT NUMBER JOBOM FOR p O THE PAC O BE'ONMMG THENCE NORTHERLY ALONGEASIER,PINT O SAID NORTHWEST SY'yG 11` rr__ PI WART.,A DISTANCE OF 18E0 FEET, M ME NOR.UNE NODE SI W W EXTENDED EASTERLY O SAID PARCEL O LAM RONI£YED BY KNOX TONMILLER.A DISTANCE O ti J V U38.0 FEET TO THE CENTER UM:Cr BARREWLE ROAD(EL.ROAISR THENCE MUTHWESTERLYALONGSAID N0. Ay00 I ti O CF2 C.B DED IERL.Y OSNEINOP ISE LAIN O]NY£FEET D BPOINT 1W' MILLER THE NORTH UTEIENCE PNL Eap W} W WESTERLY PAC O LONG SAID NWNING,IN OIFNURY22WiEDI S12RL Y,A DISTANCE O 180 FEET 10 ME t GSN I H gl EXCEPTM THEREIROR MAT PORTER O PARCEL J AND PARCEL 1 DESCRIBED ABOVE LYING WPM BARISEMLLE ROAD(GREEN STREET). PONT Of cGIWJMoevPcawr P•I SIPMrv0'NO ME VI I SURVEYOR'S CFR MCA IF STATE O ILLINOIS)Bs COUNTY O KANE) BM IS ONE MI ON HISIII1ANFCK/S NOTES I BERNARO J.DALE..AN ILLINOIS PROFESSIONAL LAM SURVEYOR.HEREBY I LAND TO BE ANNELID TO THE CITY O MCHENRY ARE THE LANDS CERTIFIES u•".Naaxo HSTTHAT RECORDRAT WAS MEPAAEO FROM MAPS,PLIES AND ODER •wusTDESCRIBEDASPARCELS1ARO2(PIN 11-02-100-012)AM PARCELS MS THE USES AND PURPOSES HEREIN SET FORTH. HONES 3 AND A(PIN 11-02-ION-011)DEED IN TRUST.RECORDED OCTOBER Mb map was crested for use os an Mnuatlan PiaL SO.20.AS DOCUMENT 2018R00J2123.NAMING.EANlI DO HERTY DATED JULY 21,2020,AD.,AT AURORA KANE COUNT:ELMS IIB Mb mop Is not to be used for any construction an stoking purposes TRUST AND KIMBERLY DONERIY MUST AS THE GRANTEES HR GREEN,INC ROVE:NWwDNautcareen[from a proper posit of HR Green.I E M/1]//FAAMbISNOTaPlotofSawyer, No assumptions or agreements as to 2 THE EXISTING CORPORATE WITS ANO CITY Cr MCHENRY ICING INFO{ 9 ownership.use,or ossesebn can be conveyed from this document.AS SHOWN NEREW.ARE DOSED UPON THE INTERACME ZOWWS MAP A_-------- Joe Wu 20/NOB No underground Enproyements have brim located union shown and noted. O G CITY O MCHENRY. F 2:'tee®'''4NodistanceWlouldbemoonedbysadbl4bttpr//m.c(mehor,EN/ BERNIARD emu.(eew.mrB...,.nrm) g S SHEET This mop Is•o1d without vlBlnal mbesese s red adored seal and h. slpnalurr affixed. WN HEREON.IS BASED UPON THE ILLINOIS PROFESSIONAL UM,SURVEYOR NO J099 No• 21/2020 9:3R:26 Pll J WiERACTIE SWINGOF MCHENRY Y COUNTY UONSE EXPIRES 11/J0/2020 1 OF 1 J:\2020\200929\9urvry\Ow9s\200929-Mnex.drq y./%mmaNrrUcsnllBha9/PPRP10 w - 1 mireime PINS:14-02-100-044 i! PLAT OF ANNEXATION TOt71THECITYOFMCHENRY SI'L milli OF PART OF THE NORTHEAST 1/4 AND NORTHWEST 1/4 OF INI, ' no: J JcI= 6. SECTION 2, TOWNSHIP 44 NORTH, RANGE 8 EAST OF THE THIRD Nor ro sC. (IIIE= PRINCIPAL MERIDIAN, MCHENRY COUNTY, ILLINOIS. CR.APIIIe rA1.r. pp CITY CLERKS CERTIFICATE APi es v ap' I p E STATE.ELIN0.5 ) Q\ es/ I 4'2¢ COUNTY OF MOONY)) SS S I ry APPRO..PURSUANT 70 OROINI L.- SY PIE ON CIA.IF I I I' COUNTY RECORDER'S fJRRRCA7F THE CITY O'MCHENRY AT ITS TEEING HELD CN STATE.EL.'S ) rF{ NU.CLERK j l COUNT'OF MO ERY)#S I W5' TIES NSINMOIT NO RFS RILED FOP RECORD N k y qEqs} y TIE AEOLApEMS OFi..YOE}RY COUNTY,LIMNS OI I!E_M I $ < DAY OF X_AT_0'a00f_44 pl'E IEnu RESORPTION OF I AN7 TO RE ANNEXED IV 774E CITY OF MCIIENRY y / F,A'\Ef' h I I Q ICC LARKIN LANE MCHENRY WVITT RECORDER S e Q gPART.THE.RIMIEST WARMER OF SEMI.2 7D0NSHP 14 NORM,RAN.B EAST. I b I W ry.PTHEn0ROPRBICIPNORTHEASTMERIDIAN.Lx5YR19E0 AS FOLLOWS LEMM.'G AT RE sW nEAST 2p. Q'a Ea 3 Q _1 CO... £ST WARIER OF SAO N.NMEST WARIER. ]KENO NORM., b Id ALONG RE EAST UNE.SAID HORMII.T WARNA 1.0 REED MERLE IRWEROY tiI / aG Id I kPARAL.L RM THE SCUM LINE OF IRE MORMEAST WARIER O"SAO MOPMIETT WARIER S C MO FEET,'MINCE SWTHEREY PARAULE NM ME EAST{NE O' 0 0 NOPMREST WARIER, n 2) / o e I I W 00FEETTOPIESCUMLANE.PE NORME.T WARIER Cr SAID NOPMMEST WARIEt t\;jW I 'dRENCEEASIER"'ALONG SAD NUM LAE 2N.0 FEET TO ME PLACE O"Be avtava N S)N w cMOEN,COUNTY.IWNOIS usro C M pap ay 2 MART.ME NORM£AST WARIER O'SECTION 2 roMI SHr CI NORM.RANCE 11 EAST OF V E MIRO PRINCIPAL MERIDIAN,DESYAOD AS FLU°. BM..H AT ME SWMEAST tV 291.0) WA') F i' CORNER O ME NCITRIEALST WARMER.IRE HORM4EST WARIER Oc SAO SECOO7 2 H W 3PIERCENORMEROYALONGM£EAST LM.SAD NOPMIIEST WARIER,IBSO FEET.'MIEN. EASIER,PANAr,n NM TIE SO.)LAC.ME NORTHEAST WARIER DI-SAD NORMNESI WARIER T ANDOED SAO FEET TO ME GORIER UNE.A IRAMED ROAD RIMING 4A I W NORMEAY SOUTHERN INKYRRT SAD SECRO7 LIEN.SCOREROY M.0 SAO WM, St LNE 1.1 FEET TO ME SCUM LINE WENDED 0 THE NORTHEAST WARIER O SNO 2 ME PLACE A NO MONEMIERcr ALOFG SUUM LINE ExrwOED 21.0 FEET TO ry1+ `,..,` wQFTV w°ems't•.I Z S' Z BARREN.RanON MAT D..THE LANDS.swraD A901;LYNG WHIN Q04'tTp}D0 2 gI W AU O maps W rm E-I Q 0 A &4 MPOINT Dm do r/d C! OISRWD CORPORATE4?(ARMS. jp0]].r/6 XL trlµ1O I ME CIE.MOE]KPY 1-i Z 2N.07 n.oJ J LAYDDEO AWE.TO ME Z Oi 1 Ri PwwPyl4." O V1 Vp yof 0 pry: pb6tipe I 5CI opR 1 Q4i 7 Qt a oscapp I 7 a/RLIYTAP's CII ER77FICATE s STALE.ELNOS) W SS fi((ROYTII/IFIR)S NOTES I mom.fume 1. [AND TO LE MNE1ID TO THE CITY.YOENRY ARE]HE[ANDS SCI0BD N O®N TRUST,RECORDED MARCH B.1998 AS 4 BRNARD 1 SALOC AN ELIAO'S PROFESSIONAL LAID 5Du",RENT 9OI01.IIRT,HMO.EDMIND N.D1'OR L/NYC TRUST AS ME CIA..MAT MIS PLAT WAS FRE ARED FNOT MAPS PUIISSSURVEYOR ORWEEDY NOTES GRAVIES HSIRI/MENUS CrRED%PM THE U.S.AND PURPOSES HERON SET P.M SET TM mop ems rioted for use se on Mncmtbn Nat 2 RE EMSINC CORPORATE LYRE AND CITY O'...TRY EONMC INFQTMmapbnottobeusedformyconstructionrroldnomoreASSM1NHEREON.ARE BASED UNFI ME NTOOCRME LOY9D MAR NR CREDODO i21,2024 AD.AT A!/NR.1,MANE COUNTY.SUMS n: 110lIR(NEO4 NG• Ills oenet ham a PM+ Sum oglmt.HR Lien,bro MI RE CITY. cherry Y. FPPeom mmll NOT a Plat of reon c. oeve tans m Me locum DIE to M1flpc// .CmrhwpEu op• AMo••,..s 2:OI/1T/2020Hebb.see,r Darlan an be conveyed from Me document Ar, ' Ho unaWyrovna Ynommnte nose been bested m a rem and noted. S EXLSMNG 2O.NEORMAMN,AS.0IN HERE..IS BASED UPON RIE 6 /--.___ g r, ':4= aB1R No MM.Wald be®umed by 104 .4 NNRACRI£2OING O'MCHENRY COUNTY.YYlTMmrstreItsv.MOiwi orlylnel ambaed r red colored,eel and Rfer//+se.1n'loor.rJ94r'R/Wrmhp HIMARD 2 LUL$R N,sey 1W ELAM PROIE590IAE'L"/I6 7UEN 3204 u:.'•".".* = 1 OF 1J/21/2020 9:513:n AM Um45E EArYES 11/50/2020 T•'.L? S E J:\2020\200924\Survey\Doge\200929-Mnn.d,R 1 PINs:14-02-200-002 PLAT OF ANNEXATION TO COUNTY RFYNDFRS C ROF7CATT c( R THE CITY OF MCHENRY CON OF MM.,)) S5 1i1 `i` INNS INSNUMENT NS WAS PEED FOR RECORD NWE , ,E,_ 1 OF PART OF THE NORTHEAST 1/4 OF SECTION 2, TOWNSHIP 44 R""°"$"MCHENRY "vS° — a in t DAY CIF ID_AT_DELOCK_.M m ME ; Mi•gl E r•';' NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN, MCHENRY COUNTY, ILLINOIS.MOEEPY GGLNIY RECORDS, C11.\r7Ur 2en7.r. a Y 1 mi)DFSCRIPDO/OF I AND TO BF ANNEYFO 7O 7HF(17Y OF MCHENRY PONT OF MAT PART OF THE WEST HALF OFLOT TWO(1)OF DE NORTHEAST Q/ARIE,OF SELTIg1 NO OMMEISSEN T)DESCRIBED AS FOLLOWS BEGR1WND AT DE ACRNWEST CORNER CE THE NORTHEAST WARIER C SECTION TIRO(2),TONNS IP H.NORM RANCE B EAST OF DIE THIRD MINORAL MERIDIAN. MINCE SCUM ALOUD TIE HALF SWIM(NE Cr SECTION TWO(2)62272 FEETFORAPLACEOB£OYRNNO•RE/NG EAST AT Mlili MUSS TO ME NORM AM SWIM HALF a. SECTION LIVE OR SECTION TWO(2)FOR A DISTANCE Or 660 FEET TO AN ANON PIE PENCE SOUTH AT RIGHT ANGLES 132 FEET TO AN IRON RPM THENCE NEST As RMIT ANGLES 660 FEED TO THE CENTER LAE OF SECTION TWO NONCE NORTH ALOVO ME CENTER NE OF TWSECTION O(1)122 FEET TO CrCrRERADEWING1ISE) ALSO 8 a1 W I ayM1 A STRIP Cr LAM TWENTY(TO)FEET WOE MNEpATELY NORTH Cr AND AL ONNG ME 126'GMNG' Z ry-yn-1•I 15NGC.''''HALNORTHERLYofUNE K ME ANERENAFTER DESCRIBED PARCEL OF UN&MAT PART OFODEOFSECTIONTOWNSHIPHNORMTHET 2 a E E S NG G . GF 1/2NENNY 1 I Z,2E-p R' T Cr THE Hass PRwOEPu YEAaAN DESCRIBED AS FOLLOWS YEOWSNc AT DE a 101 5 HOMIEST CORNER OF NORTHEAST QUARTER OF MORON 2 IP N NORM,RANGE 1 w s 0f,rl• CIVHIVOr THENCE UST AT QS\1'SW B EAST OF ME MIRO PRINCIPAL YERpAN MO RNNNG MENGE SOUTH ALONG ME HALF -s g G!! RIOYt ANGLES ICE 1)E NON SECTION UNE Cr SEVEN 2lNBAM SOWN Il5(F lOF LNE3272AEUFORAPLACEOFSECESECTION P S RE A* 0/I PO _ W 5..( SN OF MO TUT TO AN NOV PPE THENCE SOON AT RIGHT ANGLES UST FEET TO AN WON PM J MENG WEST AT RKNT ANGLES 660 PUT MI ET CENTER IRE OF SECTION 2 BENCE NORM Y NTT NC(E4 o E* ALONG MENTY,ILLINOISCENTER UNE OF SECTION 2 I.T2 FEET TO ME PLACE OF BEGINNING IN MOEHPY CCDLACEeaWB•Z or O ' ///////////////////( MO'/ MI CF SELL 2TTHATTMNART OFOF ITN RNORTHWEST SSi Or O PART OF MEPRWCP MTVzy9 0 PSN,4 NB- CTC310G' I Ill ERIa,N,DESORBEI AS FOLD CONIMONG AT ME NORM QUARTER CORNER CE SAO SECTION 2 MENU SOUMf%Y ALONG NE EAST LONE OF ME NOiMXESiMERGE70QUARTER OF 54DCrGLN OF I oar) R gu.Lavc.Tc unDISTANCE s a NaRFCMWir wARORTHERAcrOFB£a IER A a•F. vapFTEniMHB¢ Y I 0.0"G4. J / y' EASTERLYm PARALLEL RNMar MEO NORTH DISTANCEa rz BAN Nt)fLNE aCL1Wv('ry5!' NG BAVEI8L£ROAD/EL2N ROAD) DIME SOUTHWESTERLY ALONG SAO CENTER UNE A I I S',DISTANCE 0`1N12B FFET, THENCE WESTERLY PARALLEL WM THE NORTH[WE EXTENDED O'L' y NJ q'L EASTERLY OF SAD PACE Ow LAND COIKIED TIT KNOO TO NIL£R,A DISTANCE OF MO FEET G 2 I y-YS°GJ TO DE PLACE OF D£ONMNG CONTAINWG GIBS ACRE MORE CR LESS'AM BOIS SINNED N L,\2 )-LO.GNs 71 N ¢ QN.a P1G NODA roWNSVW.MCHENRY cnUNn,auNOs p„N yL:NENN I m GNSG E q% RALSOONOIGTHEREFROM O! STREET).PNPTiOV OF DE LANDS DESCRIBED ABOVE INS WRbV ExlsrelG I I 11— Ws O Lnm Lcv T or arovara (.I lE dIQ I (%) r EnsING CORPORATE LINTS CF cij S ROE.O p7T/////////////////////X/ L 4 DE S r Y MCHENRYznzypN`oNNGa% Z I Z y W p\CO- 0 ENfN W E- ExVS117 O MCHENRY IS'N OF / a' rA N R. r — j INTO70 m DE 14 e. o= o loft re gym°P „s> Yr n9' r'" ref fs+ w 1 I wpry N, y g ryo=¢ c W aQF 1 wP nQe4.h 2 10 0\20NING IN I Q p CV P p1. E y GOUN I I G 2' S O eikQ° JZ QZ E't O J EaS'' NGM, ON I2 y20 Y =U 40 y= O y20 Pr I A I W 4 W1 4Nb797 WS(SR77F7CA7F STATE OR NNW)SS J((o^FI 1ANFTMIS NOTES GOONS'OF KARE) OTT C FRK•S fYR71F7CA 1F I. LAM TO BE AIA£OD TO DE OTT Cr MOTORS ARE A PORTION OT'D,,E LaA AOS NCMS.DIVNINCSW40IMIYDEEDRECORDEDAPRILSI952NBOOKS.J.;PACER(D00EIEN T 321452) L REWARD,L BAUER,AN ILLINOIS PROFESSIONAL LAND SURIEHR HEREBY NOM STATE GE[LAMS ) tr CRT PAW DEID.REu4RAD.WAIARY S$IDSI AS DOCUMENT INNS(FM'EP11NG COUPES THAT D6 PLAT WAS ME,4R50 FROV YAPS POLIO AND TINIER l map wow anattl fly tree as m Mnsmtlan Rat SS 7IEA61OV ME LANDS L N GIST OAW DEED,RECORDED MAY 21,1963 AS NSTRIMIEHTS CE RECORD FOR THE USES AM PURPOSES HEREIN SET DORM T •^• 4 map le not N Im used fur any mmNuctkn m ob.,pugssss CaOTT CE AIOEARY) DOQAE7IJ H.YIRB),BOTH DEEDS NAMING Q£MV F.NO AR/A Al.ISBN AS GRAN/2S DAIS)ELY 2I,2020 AD-AT AURORA KANE LYTAVTY.[!DAYS N BJB• mg.': Mgout oanssnt Horn o proper court of HR Green.Inn 2 BE EASING CORPORATE LINTS MO OTC OF AIOETNY S IAMG AND.AS SHOWN IN GREEN,NGTOY5NOTaRatofStromNoamp/MW a aunt...as to APPROVED PURSUANT TO ORDNANCE BY TIE OM CCNM CE FPsswm MFam..hb.ss..v perssbn can be conveyor!Hem l. document HEREON,ARE BASm UPON DE NiERALTILE INNS YAP Cr DE Ott CE AGLEAM. AN`.,2 W/iJ/SO20No...round Improvements have been M attl unless.hown And noted.M£COY Cr 40fEIRY AT ITS NFEIWC HIED ON 20O_ ntpc//m.4mM vyew/mayw J/,/) t RMalcom*odd M mourned by sal, I EOSTNG 2ONNG IIRORMANYL AS SHOWN HEREON,IS BASED UPON THE MHRACTIIEUhl No o./ 0W wlDwut MgY9 embossed or red colored w.a me Y[LACE CLERK ZOOM OF MCHENRY COUNTY.M1IIxII.mm.i7avum/,44sn/NmnM Y Jnm SONARD 1 BAUER(6pvl7Ovgrenor m) - 7/21/2020 9:58:26 AY VAULTS PRO£59pVAL LAM sWIExR N0.,JAR MsssM ' E J:\2020\20092P\Survry\Doge\200929-Mnee.Jw9 ICES(SPREE 11/JO/MTO 1 OF 1 City of McHenry - Parcels for Annexation N N. 4'i s LM1.' F`elp dd Sii 4 peal.SrF"until Field W.e"m•s c a Ct 2 ej icr,gy ar a e i. Md1n tit rca YaUk 09-26-4$ -029,v it a WJoI nSt r P Jif) James S7 Q C 2 U NP z River sire..m W Kane Ave a CraY‘okte W Oak Ave 7.,Golfview Teri vpotonak1`;c C., v4 7,) V40 St _W Grove Ave ir,r , r an u004 ::.' r i '-.1 Mc Henry j ti Country N z N Club 3 r.1) z ki r7 G cJ WHighSt t o E b'J Lee SI s= VJ I airway Dr z G W Young St x W Skyway Dr 15 W Lorient Dr cc c W St Pauls Ave z W Bretons Dr a x Turnberry Dr v b C 4 rn 0 Knox Part ti d,:. rp Park PI y14-02-200-002 PCn Rrvrrrffront 14-02-100-011 `, Park. 14-02'='1 0-012 t len Lnx Y 14-02-100-044 C ta.,tactCa, '.t F.,. tr,rtes J AA e-R;t f ..uht ources:Esi,JIERE,Garmin,Interma.p,increment Corp,GEBCO, USGS,FAO,tllrll PS,iRCAN,IGeoBase, IGN,Kada ter NL,Ordnance Survey, Es'J Japan, METI, f Esr (Hong Kong),(c)Opg1StreetMap collntributors,and the GIS User i I Cllil 'vJ L. e9 r Community i..16.- Department of Economic Development ti McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 Phone: (815) 363-2110 1\4cHen 7 Fax: (815)363-2128 1 j jVVI www.ci.mchenry.il.us C..r o roc rot aI Ca DISCUSSION AGENDA SUPPLEMENT To: Mayor and City Council From: Douglas Martin, Director of Economic Development Date: September 2, 2020 Subject: Cannabis Dispensary at 408 S Illinois Route 31 Council may recall a petition from Crystal Clear Compassionate Care was presented to the Planning and Zoning Commission for a medical cannabis dispensary on October 16, 2019. The Planning and Zoning Commission unanimously recommended approval of a medical cannabis dispensary with several conditions. Facility may not be located within 1,000 feet of the property line of a pre- existing public or private nursery school, preschool, primary or secondary school, day care center, day care home or residential care home. Learning centers and vocation/trade centers shall not be classified as a public or private school for purposes of this section; Crystal Clear Compassionate Care shall file an affidavit with the City affirming compliance with Article III. General District Regulations Section Q. Medical Cannabis as provided herein and all other requirements of the Act Crystal Clear Compassionate Care shall install 24-hour/day 7 days/week real time video surveillance equipment, to be approved by the City, which covers/encompasses the entire exterior perimeter of 408 South Illinois Route 31, including the north, south, east and west sides of the building, common parking area to the south, east and west of 408 South Illinois Route 31 as well as the ingress/egress to the site. Additionally, equipment encompassing the interior of the building, common hallway/entrance and entire space of 408 S Illinois Route 31 shall be installed and all surveillance equipment must be in place, tested and operational prior to receipt of a certificate of occupancy; Crystal Clear Compassionate Care shall maintain on-site security personnel at all times business is conducted at the subject property; proof of such security shall be provided to the City prior to receipt of a certificate of occupancy; Department of Economic Development Rt.ri McHenry Municipal Center NINO 333 Green Street McHenry, Illinois 60050 Phone:(815) 363-2110 1\4cHen 7 Fax: (815)363-2128 ncnmr or.H<<aK a,ra www.ci.mchenry.il.us If a conditional use permit is approved there shall be no residential dwelling units permitted on subject property at any time the dispensary remains in operation; A photometric plan must be submitted verifying minimum parking lot lighting requirements are met. If the regulations are not met, additional/new lighting standards must be installed in accordance with all City ordinance requirements prior to granting an occupancy permit for the proposed medical marijuana dispensary; For purposes of determining required parking, Medical Cannabis Dispensing Organizations shall be classified as "Other Retail and Personal Service" in accordance with Article VII Off-Street Parking & Loading Table 13: Required Parking Spaces for Non-Residential and Non-Lodging Uses and the proposed dispensary on subject property shall comply with said regulation; Conditional Use Permit for a dispensary on the subject property shall be null and void if Crystal Clear Compassionate Care Inc. does not secure a license to operate a medical marijuana dispensary from the Illinois Department of Financial and Professional Regulation by December 31, 2020. The petition was subsequently heard by the City Council at its October 28, 2019 Special City Council meeting. The City Council approved the petition 5-2 in accordance with the Planning and Zoning and Commission recommendation. At this time, John and Rosemary Swierk are seeking feedback from the City Council on a potential recreational cannabis facility at this same location. The medical cannabis facility is no longer an option at this site due to licensing. However, they are seeking approval for a recreational cannabis dispensary at this site. A recreational cannabis facility will require a conditional use permit from the City, public hearing before the Planning and Zoning Commission and subsequent approval by the City Council. At this point, the applicants are seeking general feedback on the from the Council regarding the proposed use prior to entering the formal review process as outlined above. M^ Department of Community& Economic Development McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 McHenr Phone: (815) 363-2170 Fax: (815) 363-2173 www.ci.mchenry.il.us DISCUSSION AGENDA SUPPLEMENT TO:Mayor and City Council FROM: Ross Polerecky, Community Development Director FOR: September 8, 2020 Regular City Council Meeting RE:Discussion related to vacation of right of way in the Hanly subdivision. Agenda Item Summary: Staff has been approached by a homeowner in the Hanly subdivision requesting the City of McHenry vacate a 16'dedicated right of way the runs behind his property. The homeowners have been maintaining this strip of land and the city has no utilities or other infrastructure located in this strip. The homeowner is willing to incur all expenses related to the vacation. The request is being made so the homeowner can legally fence in this portion he has been maintaining. Background: Hanly Subdivision was platted in 1893,a 16'strip of dedicated property running north/south in the middle of the block was platted,there is no mention of what this strip was to be used for, property owners along this strip have been maintaining it and are requesting the city vacate it.The City of McHenry has no utilities or infrastructure in the dedicated right of way. Per the Plat Act each homeowner in the subdivision would receive 50% of the strip that runs along their property. The strip is 16' wide so each homeowner would receive an additional 8' of rear yard. The homeowner requesting this vacation is willing to take on the expense of having HR Green create a plat of vacation which would came back before council for approval. Recommendation: If the City Council concurs it is recommended that a plat of vacation be prepared by HR Green and all costs associated with the vacation be incurred by the homeowner who is requesting. The plat of vacation will be brought before Council at a later date for approval. Department of Community& Economic Development McHenry Municipal Center J33 Green Street McHenry, Illinois 6OUS0 Phone: (815) 21700~ v./& &«^/8 88 Fax: (815) 363'2I73 wwxvzimchenryjius 74 fo PAOLA NIX Department of Community& Economic Development McHey Municipn D333 Greenal Street ter M McHenrynr , Illinois 60050 cHenr Phone: (815) 363-2170Ce Fax: (815) 363-2173 www.ci.mchenry.il.us 2`212' v 4- " \ 2/ 4 \ \• i•• \\ . y\• _ \_ . Scull No' So I°..- . _1. se_ __ t\ s; 54/ y., 7 the v Q/ •' 4 is Q 4 O C" 4; 09 S V Ic2 J 0 4 ' yo` 60 r/ 9 t s.em4Y7 / is 4 5 7 • aurnuv V. 3 s .' I NrVWQV` G.iv . .J'` . N1 O / AA. Sl.w 4.\.,av k vim\ a 1.•n F a Department of Community& 4.Economic Development McHenry Municipal Center V ilft 333 Green Street McHenry, Illinois 60050 McHenr Phone: (815) 363-2170 Fax: (815) 363-2173 www.cityofmchenry.org DISCUSSION AGENDA SUPPLEMENT TO:Mayor and City Council FROM: Ross Polerecky, Community Development Director Troy Strange, P.E., Public Works Director FOR: September 8, 2020 Regular City Council Meeting RE:Correction to December 2019 Update of Capital Development Fee Structure ATT: Revised & Final Capital Development Fee Study Agenda Item Summary: Staff is again bringing forward water and sewer capital development fees for discussion by City Council due to an oversight in recently completed Capital Development Fee Study. This oversight resulted in the fees being set at non-representative values which are in excess of the City's true need based upon population equivalent (PE) projections for future development. These values will need to be adjusted downward based upon corrections to the study, recommendations from staff, and direction from City Council. Background: In 2019, Staff was directed by City Council to hire a firm to complete a study of water and sewer capital development fees. This effort was undertaken after a temporary reduction in capital development fees was passed which was associated with the transfer of previously platted subdivision lots to new developers who restarted residential construction at those locations. Baxter and Woodman, Inc. was selected from the City pool of prequalified firms and retained by Staff to complete the study. The study was finalized in December of 2019, and new capital development fees were adopted based upon the final report. At the time of adoption in December of 2019,the updated fees were increased above the current fee structure in most cases and were within the same order of magnitude as the previous fees and therefore seemed reasonable. Upon further review, it was discovered that the adopted fees were mistakenly inflated. This calculation error was due to the cost per household numbers being multiplied by the average number of persons per household to determine the fee for each type of household despite the fact that this factor of persons in each household was already Department of Community& Economic Development v McHenry Municipal Center 333 Green Street McHenry, Illinois 60050 Phone: (815) 363-2170 McHenr Fax: (815) 363-2173 www.ci.mchenry.il.us applied to the calculation. In order to come to the correct figure, each of the fees must be adjusted back by dividing the figure over the number of persons per type of household. To rectify the error, Staff has performed an additional review of the study and has requested Baxter and Woodman to correct the report, which has been completed. Staff has determined that there are two reasonable options for correcting the issue: the fees can be reverted back to the old structure, or the fees can be adjusted to the newly revised and significantly lowered fee structure included in the updated final report. Staff is bringing the correction in fees before Council for discussion with the intent of a final fee correction and update to be adopted at the next available City Council meeting. RECOMMENDATION: Therefore, if Council concurs, a motion shall be brought forward at a near future City Council meeting to adjust the fees which are reflective of the City's true need for water and sewer system expansion and corrections to the Capital Development Fee Study. a City of c enr 2019 Capital Development Fee Study Revised April 2020 1.00- 41K61w, . i: - BAXTE OODMAN Consulting Engin, City of McHenry, Illinois 2019 Capital Development Fee Study TABLE OF CONTENTS Section Page No. EXECUTIVE SUMMARY 1. INTRODUCTION 1.1 Study Purpose and Scope 11 1.2 Existing System 11 1.3 Planned Land Use 12 2. WATER SYSTEM 2.1 Existing Conditions 14 2.2 Near Future Development Conditions 14 2.3 Water Distribution System 15 2.4 Elevated Storage 15 2.5 Wells and Water Treatment Plants 17 2.5.1 Near Future Development Demands 18 2.5.1.1 Near Future Developments: Option 1 19 2.5.1.2 Near Future Developments: Option 2 20 2.5.2 Distant Future Development Demands 21 2.6 Recommendations 22 3. SANITARY SEWER SYSTEM 3.1 Existing Conditions 23 3.1.1 Introduction 23 3.1.2 Existing Trunk Sewer Analysis 23 3.1.3 Lift Station Analysis 24 3.2 Future Demands 25 3.2.1 Bull Valley Trunk Sewer 25 3.2.1.1 Legend Lakes Development 25 3.2.1.2 West Dartmoor Lift Station 25 3.2.1.3 Preserves of Boone Creek Development 26 3.2.1.4 Legend Lakes Part 2 Development 27 3.2.1.5 Fieldstone Lift Station 27 3.2.1.6 Bull Valley Trunk Sewer 27 3.2.2 Oaks at Irish Prairie Trunk Sewer 28 3.2.2.1 Oaks at Irish Prairie Development 28 3.2.2.2 Doolin Lift Station 28 3.2.2.3 Oaks at Irish Prairie Trunk Sewer(McHenry Shores Subdivision)29 3.2.2.4 South Riverside Lift Station 29 3.2.3 Route 120 Trunk Sewer 30 3.2.3.1 Future Developments at Route 120&Chapel Hill Road 30 City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAITER oODNAll 3.2.3.2 Route 120 Lift Station 30 3.2.3.3 Route 120 Trunk Sewer between Route 120 & River Road Lift Stations 31 3.2.3.4 River Road Lift Station 31 3.2.3.5 Route 120 Trunk Sewer between River Road&Boone Lagoon Lift Stations 32 3.2.3.6 Boone Lagoon Lift Station 32 3.3 Recommendations 33 4. WASTEWATER SYSTEM 4.1 Existing Conditions 34 4.1.1 Background 34 4.1.2 McHenry WWTP&Regional Pump Station 34 4.2 Future Demands 35 4.2.1 Near Future 36 4.2.2 Distant Future 38 4.3 Recommendations 39 4.3.1 NPDES Plant Re-Rating 39 4.3.2 Addressing Infiltration and Inflow 41 4.3.3 Wastewater Capacity Discussion 41 5. CAPITAL DEVELOPMENT FEE 5.1 Existing Capital Development Fee 43 5.2 Water Capital Development Fee 44 5.3 Sanitary Sewer Capital Development Fee 46 5.4 Comparison of Neighboring Development Fees 48 LIST OF TABLES Table Page No. 1 Near Future (<20 years) Development Projected Population Equivalents 12 2 Distant Future (>20 years) Development Projected Population Equivalents 13 3 Existing Water Demands 14 4 Near Future Development Additional Water Demand 15 5 Existing Elevated Storage Tanks 16 6 Elevated Storage Tank Evaluation 16 7 Existing Wells and Water Treatment Plants 17 City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTER WOODMAN TABLE OF CONTENTS Page 4 8 City of McHenry WTP's Operating Runtimes 18 9 WTP's Operating Runtimes with Near Future Development 19 10 WTP's Operating Runtimes with Near Future Development: Option 1 20 11 WTP's Operating Runtimes with Near Future Development: Option 2 20 12 Distant Future Development Additional Water Demand 21 13 Water Distribution Improvement Cost Summary 22 14 Existing Lift Stations 24 15 Dartmoor Drive Sewer Capacity Evaluation 25 16 West Dartmoor Lift Station Evaluation 26 17 Eaglewood,Newport&Fieldstone Sewer Capacity Evaluation 27 18 Bull Valley Road Sewer Capacity Evaluation 28 19 Doolin Lift Station Evaluation 28 20 Barreville Road&Pearl Avenue Sewer Capacity Evaluation 29 21 South Riverside Lift Station Evaluation 29 22 Route 120 Lift Station Evaluation 30 23 Route 120 Sewer Capacity Evaluation to River Road Lift Station 31 24 River Road Lift Station Evaluation 31 25 Boone Lagoon Lift Station Evaluation 32 26 Trunk Sewer&Lift Station Cost 33 27 Trunk Sewer&Lift Station Cost with Freund Lift Station Diversion 33 28 NPDES Permit Effluent Limit Requirements 35 29 Hydraulic Load Projection 36 30 Organic Load Projection 37 31 Solids Load Projection 38 City of McHenry,Illinois 2019 Capital Development Fee Study•190382.30 IAXTER. WOODMAN TABLE OF CONTENT Page 5 32 Distant Future Hydraulic Load Projections 39 33 Max Concentration to Meet Load Limit at a 4.5 MGD Re-Rate 40 34 Re-Rate Now Versus at a Future Date Comparison 41 35 Wastewater Capacity Summary Table 42 36 Existing Residential Water&Sewer Capital Development Fee Structure 43 37 Water System Capacity Improvement Costs per Average Household 44 38 Residential Water Capital Development Fee Structure 44 39 Commercial and Industrial Water Capital Development Fee Structure 45 40 Existing&Proposed Water Capital Development Comparison 45 41 Sewer Capital Development Fee for Average Household 46 42 Residential Sewer Capital Development Fee Structure 46 43 Commercial and Industrial Capital Fee Structure 47 44 Existing&Proposed Sewer Capital Development Comparison 47 LIST OF APPENDICES Appendix A Population Equivalent Projections B McHenry Wastewater Treatment Plant NPDES Permit C Water Connection Fee Comparison Survey D Sanitary Sewer Connection Fee Comparison Survey LIST OF EXHIBITS Exhibit A Study Area Map City of McHenry,Illinois 2019 Capital Development Fee Study•190382.30 BAXTER WOODMAN TABLE OF CONTENTS z.._. _. .,.. .-. Pag B Water System C Sanitary Sewer System LIST OF ABBREVIATIONS BOD5 five day biochemical oxygen demand cfs cubic feet per second EPA Environmental Protection Agency ft feet gpd gallons per day gpm gallons per minute in inches I/I infiltration/inflow lbs pounds LS lift station max maximum MG million gallons (or mil gal) MGD million gallons per day mg/L milligrams per liter(parts per million in dilute solutions) MH manhole min minimum NH3 ammonia nitrogen PE population equivalent SSES sanitary sewer evaluation survey TP total phosphorous TSS total suspended solids (or SS) WTP water treatment plant WWTP wastewater treatment plant City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTER. sM00DMAII EXECUTIVE SUMMARY Page EXECUTIVE SUMMARY This report is intended to review the required capacity improvements to the City of McHenry's water supply, water treatment, wastewater collection, and wastewater treatment processes in order to handle the planned developments that will occur within the next twenty years.The anticipated Near Future Development is anticipated to introduce approximately 5,000 additional water and wastewater users,most of which is residential with some commercial. Additional development was discussed beyond the twenty years for long term planning purposes only (Distant Future Developments),and introduces another 10,000 additional water and wastewater users that is largely residential. A review of the existing water treatment capacity shows that the Near Future Developments will require an additional water treatment plant to meet the projected maximum daily demands.The City has previously invested in designs for a new water treatment plant at two potential sites. Well 11,which is located on the east side of the Fox River,would provide additional redundancy due to the location and can meet the demands of the Near Future Developments. However, any developments beyond the Near Future Developments would require the construction of another treatment plant. A second treatment plant was designed around the existing Well 12, which has a deep well,Well 13, already installed nearby. Well 13 would provide the City with an abundance of capacity to last beyond the Near Future Developments and well into the Distant Future Developments. Three water capital development fees are proposed depending on the decision the City decides to take. Option 1 provides the rates if a treatment plant is built around Well 11 with the cost spread over the Near Future Development population projection.Option 2 provides the rates if a treatment plant is built around Wells 12 and 13 with the costs spread over the Near Future Development population projection. Option 3 provides the rates if a treatment plant is built around Wells 12 and 13 with the costs spread over the Near and Distant Future Development population projections. Commercial and Industrial Water Capital Development Fee Structure Option 1 Option 2 Option 3 Capital Capital Capital Capacity Development Fee Development Fee Development Fee Meter Size Ratio Well 11 Wells 12/13 Wells 12/13 5/8"x 3/4" 1.00 2,590 3,920 1,120 1"2.80 7,252 10,976 3,136 1-1/2" 4.80 12,432 18,816 5,376 2"8.00 20,720 31,360 8,960 3" 18 46,620 70,560 20,160 City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTEROODMAN EXECUTIVE SUMMARY Page 8 Option 1 Option 2 Option 3 Capital Capital Capital Capacity Development Fee Development Fee Development Fee Meter Size Ratio Well 11 Wells 12/13 Wells 12/13 4" 50 129,500 196,000 56,000 6" 50 129,500 196,000 56,000 8" 180 466,200 705,600 201,600 Residential Water Capital Development Fee Structure Total Person Option 1 Option 2 Option 3 per Capital Capital Capital Dwelling Development Fee Development Fee Development Fee Type of Unit Unit Well 11 Wells 12/13 Wells 12/13 Detached Single-Family 2 Bedroom 2.017 1,899 2,870 819 3 Bedroom 2.899 2,729 4,125 1,177 4 Bedroom 3.764 3,543 5,356 1,528 5 Bedroom 3.770 3,549 5,364 1,530 Attached Single-Family 1 Bedroom 1.193 1,123 1,698 484 2 Bedroom 1.990 1,873 2,832 808 3 Bedroom 2.392 2,252 3,404 971 4 Bedroom 3.145 2,960 4,475 1,276 Apartments Efficiency 1.294 1,218 1,842 525 1 Bedroom 1.758 1,655 2,502 714 2 Bedroom 1.914 1,802 2,724 777 3 Bedroom 3.053 2,874 4,344 1,239 A review of the existing sanitary sewer system shows that the Near Future Developments will require upgrading portions of the existing trunk sewers and lift stations to be able to convey the additional projected wastewater. The sanitary sewer system contribution to the sewer capital development fee is the cost to increase the size of the trunk sewer and force main piping,and lift station capacity upgrades. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTER I ODMAN EXECUTIVE SUMMARY' A review of the existing wastewater treatment plant capacity shows that the Near Future Developments will not require additional capital improvements to treat the projected hydraulic load to plant.The Near Future flow contribution is projected to put the treatment plant at approximately 91% of its total rated hydraulic capacity. The Distant Future flow contribution, assuming all Near Future Developments are added first, will put the treatment plant at 17% over its total rated hydraulic capacity. The City's South Consolidated Wastewater Treatment Plant was permitted for 4.0 MGD Design Average which is a net loss of 0.5 MGD from the pre-consolidation status. Approaching a re-rate to 4.5 MGD at a future date would provide additional capacity to service the Distant Future Developments.The wastewater contribution to the sewer capital development fee is the cost for the re-rate process,which would include the development of a Facility Plan Report. The sewer capital development fee accounts for sanitary sewer and wastewater treatment capital improvements. Option 1 provides the Capital Development Fee under the required improvements for the Near Future Developments with no upgrades to the Freund Lift Station,which would divert flow to the Millstream Lift Station.Option 2 provides the Capital Development fee with the upgrades to the Freund Lift Station made within the near future which would alleviate capacity issues downstream of the Freund Lift Station. Commercial and Industrial Sewer Capital Development Fee Structure Option 1 Option 2 Sewer Capital Sewer Capital Meter Size Capacity Ratio Development Fee Development Fee 5/8"x 3/4" 1.00 1,923 1,437 1" 2.80 5,384 4,024 1-1/2" 4.80 9,230 6,898 2" 8.00 15,384 11,496 3" 18 34,614 25,866 4" 50 96,150 71,850 6" 50 96,150 71,850 8" 180 346,140 258,660 City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAETER5OODMAN EXECUTIVE SUMMARY 1111111111M11111111111111111111.11116, Page 10 Residential Sewer Capital Development Fee Structure Option 1 Option 2 Total Person per Capital Capital Type of Unit Dwelling Unit Development Fee Development Fee Detached Single-Family 2 Bedroom 2.017 1,410 1,053 3 Bedroom 2.899 2,027 1,514 4 Bedroom 3.764 2,631 1,966 5 Bedroom 3.770 2,635 1,969 Attached Single-Family 1 Bedroom 1.193 834 623 2 Bedroom 1.990 1,391 1,039 3 Bedroom 2.392 1,672 1,249 4 Bedroom 3.145 2,198 1,643 Apartments Efficiency 1.294 905 676 1 Bedroom 1.758 1,229 918 2 Bedroom 1.914 1,338 1,000 3 Bedroom 3.053 2,134 1,594 A survey of neighboring and similar communities' development fees was conducted as part of this study.The survey required minor assumptions to compare development(connection) fee structures that do not match McHenry's existing fee structure. The results for the Water and Sanitary Sewer Development Fees are shown in Appendix C and D. Overall,the existing McHenry Capital Development Fees are approximately average,if not lower than its surrounding municipalities. Only Option 2 under the Water Connection fee causes an immediate increase in the City's Water Connection Fee.A notable exception to this is where no comparison exists against the neighboring communities due to differences in fee structure or higher capacity ratios for the larger non-residential meter sizes which drive the rates up higher than others. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTER O0DMAB 1. INTRODUCTION pag 1. INTRODUCTION 1.1 Study Purpose and Scope The City of McHenry, located in the eastern portion of McHenry County, Illinois, is currently home to approximately 27,000 people as of the 2017 Census and has seen no major growth since 2008. Although the City is not expecting significant future growth, there are a number of developments expected to occur within the next twenty years that could drive the need for additional water and wastewater infrastructure capacity.Baxter&Woodman,Inc.prepared the last Capital Development Fee for Water and Sewer in 2004,and the City has not made modifications to those rates since.The purpose of this report is to analyze and propose new capital development fees that would accurately reflect the upcoming developments and their planned impacts to the existing infrastructure capacity. The purposes of this Water and Wastewater Capital Development Fee Study are: 1. Review the size and capacity of the existing water supply, treatment, storage facilities, wastewater treatment capacity,lift stations,and distribution/collection mains; 2. Determine the adequacy of the water and wastewater facilities; 3. Project the population growth of planned and proposed developments and determine their impacts on the existing system's capacity. 4. Estimate the cost of any infrastructure improvements to the system to handle the additional capacity required. 5. Propose the amount of capital development fees to be collected for water and sewer using the City's current fee structure. 1.2 Existing System The City owns and operates a full water treatment and distribution system,a wastewater treatment plant,sanitary lift stations and a sewer collection system. The City of McHenry is largely comprised of residential water and wastewater users and some commercial and industrial users.Notable large system capacity user is the Northwestern Medicine McHenry Hospital located in the south end of the City. The water treatment system includes four primary water treatment facilities, 129 miles of water main,and two emergency backup wells with no treatment Each primary water plant is supplied by two shallow wells of varying capacities. The system also includes four elevated storage tanks that provide additional storage,pressure,and fire flow. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 EAETEOODMAN The City's wastewater treatment facilities were consolidated in early 2018 which included decommissioning the Central Wastewater Treatment Plant and converting it into a Regional Booster Pumping Station. The Regional Booster Pumping Station collects the wastewater flow that was formerly treated by the Central Wastewater Treatment Plant and sends it to the South Consolidated Wastewater Treatment Plant. Sewage is collected through approximately 12 miles of gravity sewer and force mains and 19 lift stations, which convey sewage to either the Regional Booster Pumping Station or directly to the South Consolidated Wastewater Treatment Plant. 1.3 Planned Land Use The City of McHenry has identified potential developments into two major groups, which are categorized by whether the development is planned to occur within 20 years (Near Future Development) or after 20 years (Distant Future Development).This study primarily focuses on the developments planned to occur within the next 20 years to estimate the reasonable amount of growth without oversizing any infrastructure system. Each development that was identified was provided in acreages and, if applicable, a percentage breakdown of land use between residential and commercial. There are currently no planned industrial developments that the City is aware of that would contribute significant wastewater loads or add substantial demands to the water system. Tables 1 and 2 provide a summary of the planned near future and distant future developments respectively and their population equivalent (PE) contributions for planning purposes. Appendix A provides a detailed breakdown of the PE calculation for each planned development and Exhibit A is a map showing the proposed development locations. TABLE 1 Near Future (<20 years) Development Projected Population Equivalents Total Development Type Acres Total PE Legend Lakes(1) Single Family 165 375 Legend Lakes Part 2 Single Family 80 756 Preserves of Boone Creek Single Family 115 1,068 Oaks at Irish Prairie Single Family 75 700 Bull Valley&Curran Commercial 20 100 West of Chapel Hill Road (south of 120) Single Family&Commercial 75 642 East of Chapel Hill Road (south of 120) Single Family&Commercial 110 942 TOTAL 640 4,582 1) Planned Development will only connect to McHenry's sanitary sewer. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTER WOODMAN 1. INTRODUCTION Page 13 TABLE 2 Distant Future (>20 years) Development Projected Population Equivalents Total Development Type Acres Total PE South of Bull Valley&Curran Single Family 230 1,701 East of Crystal Lake Road Single Family 545 4,583 North McCullom Lake Road Single Family 335 3,166 120 &Martin Road Single Family 95 898 Chapel Hill Road (north of 120) Single Family&Commercial 100 193 TOTAL 1,305 10,540 City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAITER ANOODMAB 2. WATER SYSTEM Page 2. WATER SYSTEM 2.1 Existing Conditions The City of McHenry operates its water distribution system as a single pressure zone that is comprised of four water treatment plants,four elevated storage tanks,and approximately 129 miles of water main.The City of McHenry is divided by the Fox River,with only a single main crossing the river located just north of Pearl Street and North River Road.A majority of the infrastructure exists on the west side of the river,with only Elevated Tank 3 and a backup well (Well 11) active on the east side. The 2017 population for the City of McHenry was 27,022,however the entire City is not served with City water. The following subdivisions are served by private wells:Burning Tree,Deerwood Estates, Glacier Ridge,Martin Woods,McHenry Shores,Woodcreek and Wooded Ridge. The total population served by City water is 23,335. A summary of the existing water demand is provided in Table 3. TABLE 3 Existing Water Demands 2014 2015 2016 2017 2018 Average Daily Demand (mgd) 2.30 2.16 2.14 2.15 2.06 Average Usage per PE 100 94 93 92 88 2.2 Near Future Development Conditions The increase in water demand was projected for the Near Future Developments with the Population Projections from Section 1. The total population projection is 4,582 P.E for Near Future Developments, but is reduced to 4,207 PE since the Legend Lakes development will only be connecting to the sanitary sewer system.The future water demand is estimated by assuming a water usage factor of 90 gpd per P.E.which is the average usage based on 2017 and 2018 data. Table 4 below shows the additional average day and max day demand for the Near Future Development. A peaking factor of 1.8 is used to estimate the max day demand, which is based on City data. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 6AITE1 OODMAN 2. WATER SYSTEM Page 15 TABLE 4 Near Future Development Additional Water Demand Additional Average Day Demand (gpd) 378,639 Peaking Factor 1.8 Additional Max Day Demand (gpd) 681,550 Existing Average Day Demand (gpd) 2,088,000 Total Average Day Demand (gpd) 2,466,639 Existing Max Day Demand (gpd) 3,402,700 Total Max Day Demand (gpd) 4,084,250 2.3 Water Distribution System A detailed analysis of the existing water distribution system was not completed without a working water model. A review of the water main sizing and layout in the vicinity of the proposed developments was done to determine if any new water main are required to provide adequate water main looping. The following water distribution system improvements are needed: The new Legend Lakes and Preserves at Boone Creek developments will require 2,500 feet of 12-inch water main on Bull Valley Road from Curran Road to the existing 12-inch stub near Brookwood Trail. The new developments at West and East of Chapel Hill Road and south of Route 120 will require approximately 1,000 feet of 12-inch water main along Route 120 from Adams Drive to the edge of the development property. This will be an unlooped water main until development east of Chapel Hill Road and north of Route 120 is developed which is part of the Distant Future Development projection. These water distribution improvements are shown on Exhibit B. 2.4 Elevated Storage The City has four elevated storage tanks that provide a total capacity of 2.75 MGal. A summary of the elevated storage tanks is provided in Table 5 below. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BARTER'WOODMAN 2. WATER SYSTEM Page 16 TABLE 5 Existing Elevated Storage Tanks Tank 1 Tank 2 Tank 3 Tank 4 Location Sioux Lane Albany Street Barney Court& Crystal Lake Road Richard Court Year Constructed 1961 1985 2000 2006 Volume (MGals) 0.5 0.5 0.75 1.0 HWL (ft) 153 160 160 LWL (ft) 123 63.3 129.3 68.8 Ground Elevation (ft) 787 829 820 Elevated tanks provide water to meet the maximum hourly demands,water for fire protection,and a reserve capacity. Maximum Hourly Demand-Storage facilities must provide the difference between the firm capacity of the wells and the maximum hourly rate or usage. Fire Flow Demand-Volume for fire flow is based on 3,500 gpm for a duration of 3 hours. Reserve Capacity-An additional amount of storage is required to provide reserve supply of water to meet the demands during emergencies and provide capacity in the event of a fire occurring when a tank is partially fully. A reserve capacity of 20%was used. This criteria was used along with the existing water usage and proposed water usage for the Near Future Developments,shown in Table 6,to evaluate the storage needs for the City. TABLE 6 Elevated Storage Tank Evaluation Existing Future Maximum Hourly Demand (MGal)0.90 1.21 Fire Flow(MGal) 0.63 0.63 Reserve Capacity(MGal) 0.31 0.37 Total Required Storage (MGal) 1.84 2.12 Existing Storage (MGal) 2.75 2.75 Adequate Storage Yes Yes The City has adequate elevated storage to accommodate the proposed Near Future Developments. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 AXTEESOOCMAll 2. WATER SYSTEM Page'M 2.5 Wells and Water Treatment Plants Each of the four water treatment plants are fed by two shallow wells,and there are two emergency backup wells currently available in the system.A third backup well,Well 13,has been drilled near the current location of Well 12 but a deep well pump has not been installed therefore it currently is not active. Well 13 was previously tested and it is anticipated that the well can produce between 1,000-1,200 gpm. The four elevated storage tanks control the water treatment plants. Generally, control is based off of tower levels within the elevated tanks that are assigned to the water treatment plant.When the level in the tank falls to a lower setpoint,the water treatment plant will be called to run and produce water into the system.The plant will continue to run until the tank reaches its higher setpoint.Table 7 summarizes the capacities of the water treatment plants and backup wells. TABLE 7 Existing Wells and Water Treatment Plants Pumping Capacity(gpm) WTP 1 Well 2 400 Well 3 275 Total 675 WTP 2 Well 5 490 Well 6 450 Total 940 WTP 3 Well 7 242 Well 8 203 Total 445 WTP 4 Well 9 725 Well 10 375 Total 1,100 Emergency Back-up Wells No Treatment) Well 11 500 Well 12 500 Total 1,000 Monthly pumping data from each treatment plant was analyzed over a five year period between 2014 and 2018 to determine the average flow from each plant. Collectively, the water produced from each plant provided 2,088,000 gallons per day(2.1 MGD)over the five year period to the entire system. Each treatment plant generally saw a reduction in usage over the five year period between City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 IA1TEI 5 OODNAII 2. WATER SYSTEMIIIIIMIIIMM11.1111=11111=1=111=11111k. Page 18 50 to 100 gallons per day with the exception of Water Treatment Plant 3 which saw a gain of approximately 20 gallons per day compared to its five year average. The maximum daily flow for each treatment plant was found from daily pumping records from January 2018 through March 2019. The max day demand observed was 3,402,700 gallons, with Water Treatment Plant 2 running for over 19 hours. Typically, wells are not recommended to run beyond 18 hours a day to allow for adequate recharge. Table 8 summarizes the average and max pumpage and runtimes for each treatment plant. TABLE 8 City of McHenry WTP's Operating Runtimes WTP 1 WTP 2 WTP 3 WTP 4 Well 11* Well 12* Max Well Pump Capacity 675 940 700 1,100 500 500 gpm) Average Daily Pumpage 348,000 611,000 409,000 720,000 0 0gpd) Average Runtime 8.6 10.8 9.7 10.9 0 0hrs./day) Max Daily Pumpage 635,000 1,107,000 626,000 1,034,700 0 0gpd) Max Daily Runtime 15.7 19.6 14.9 15.7 0 0hrs./day) Peaking Factor 1.8 1.8 1.5 1.4 Wells 11 and 12 are emergency backup wells and are not used on a regular basis. 2.5.1 Near Future Development Demands The total additional average and max day demands were split equally between the four existing water treatment plants to see whether the existing infrastructure could handle the load for the proposed Near Future Developments. Table 9 below shows the required run times for each treatment plant to meet the total average and max day demands with the Near Future Developments fully built out. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTER "WOODMAN 2. WATER SYSTEM Page 19 TABLE 9 WTP's Operating Runtimes with Near Future Development WTP 1 WTP 2 WTP 3 WTP 4 Well 11* Well 12* Max Well Pump Capacity 675 940 700 1,100 500 500 gpm) Average Daily Pumpage 442,660 705,660 503,660 814,660 0 0gpd) Average Runtime 10.9 12.5 12.0 12.3 0 0hrs./day) Max Daily Pumpage 805,388 1,277,388 796,388 1,205,088 0 0gpd) Max Daily Runtime 19.9 22.7 19.0 18.3 0 0hrs./day) Wells 11 and 12 are emergency backup wells and are not used on a regular basis. Although the existing infrastructure can handle the additional average day demands,the projected max day demands push the treatment plants beyond the recommended 18 hours of run time per day.Therefore,an additional water treatment plant is required to cover the additional demand.The City of McHenry has previously investigated two potential options for the buildout of Water Treatment Plant 5. The first option was to construct Water Treatment Plant 5 around the existing Well 11,which would allow the City to have a treated source of water on the east side of the Fox River with Elevated Tank 3. Plans and preliminary designs were created in 2002 by Baxter&Woodman,Inc. The second option was to construct Water Treatment Plant 5 around existing Wells 12 and 13,which would provide the City with more capacity through the combined flows of a shallow and deep well. Plans and preliminary designs were created in 2007 by Donahue&Associates,Inc. 2.5.1.1 Near Future Developments: Option 1 The addition of Water Treatment Plant 5 at Well 11 on the east side of the Fox River would add about 500 gpm into the system.In order to meet the projected average and max day demands,run times between the five treatment plants were balanced to verify that none of the wells would run over 18 hours a day. Table 10 below summarizes the required run times from each treatment plant to meet demand. It should be noted however, that these values may differ from reality based on which elevated tanks control each treatment plant. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 IAZTERECOODMAN 2. WATER SYSTEM Page 20 TABLE 10 WTP's Operating Runtimes with Near Future Development: Option 1 WTP 1 WTP 2 WTP 3 WTP 4 Well 11 Well 12* Max Well Pump Capacity 675 940 700 1,100 500 500 gpm) Average Daily Pumpage 425,250 592,200 441,000 693,000 315,000 0gpd) Average Runtime 10.5 10.5 10.5 10.5 10.5 0hrs./day) Max Daily Pumpage 708,750 987,000 735,000 1,155,000 510,000 0gpd) Max Daily Runtime 17.5 17.5 17.5 17.5 17.0 0hrs./day) Well 12 is an emergency backup well. Although the combined flows from all five treatment plants would be enough to meet the max day demand without exceeding 18 hours run time, it is likely that due to uneven consumption of water through the system, some treatment plants may run longer than others. In the event a treatment plant is unavailable,this may cause a scenario in which the system can't keep up with demand. 2.5.1.2 Near Future Developments: Option 2 The addition of Water Treatment Plant 5 at Wells 12 and 13 would add about 1,700 gpm into the system. In order to meet the projected average and max day demands, run times between the five treatment plants were balanced to verify that none of the wells will run over 18 hours a day.Table 11 summarizes the required run times from each treatment plant to meet demand. It should be noted however,that these values may differ from reality based on which elevated tanks control each treatment plant. TABLE 11 WTP's Operating Runtimes with Near Future Development: Option 2 WTP 1 WTP 2 WTP 3 WTP 4 Well 11* Wells 12/13 Max Well Pump Capacity 675 940 700 1,100 500 1,700 gpm) Average Daily Pumpage 344,250 451,200 336,000 528,000 0 816,000gpd) Average Runtime 8.5 8.0 8.0 8.0 0 8.0hrs./day) Max Daily Pumpage 546,750 761,400 567,000 891,000 0 1,326,000gpd) Max Daily Runtime 13.5 13.5 13.5 13.5 0 13.0hrs./day) Well 11 is an emergency backup well. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAITER WOODMAN This option would require a deep well pump to be purchased and installed at existing Well 13 in addition to the construction of the water treatment plant at Well 12.The larger capacity of a deep well helps to cut down on the overall run times of several of the smaller wells, reducing the stress on the ground water table. The average run times of 13.5 hours a day during peak demand allows for adequate time for the wells to adequately recharge. 2.5.2 Distant Future Development Demands The increase in water demand was projected for the Distant Future Developments with the Population Projections from Section 1. The population projection for the Distant Future Developments is an additional 10,540 PE. Table 12 shows the additional average day and max day demand.A peaking factor of 1.8 is used to estimate the max day demand. TABLE 12 Distant Future Development Additional Water Demand Additional Average Day Demand (gpd) 948,623 Peaking Factor 1.8 Additional Max Day Demand (gpd) 1,707,521 Existing Average Day Demand (gpd) 2,088,000 Near Future Average Day Demand (gpd) 378,639 Total Average Day Demand (gpd) 3,415,262 Existing Max Day Demand (gpd) 3,402,700 Near Future Max Day Demand (gpd)681,550 Total Max Day Demand (gpd) 5,791,771 If Water Treatment Plant 5 is constructed around Well 11 in order to meet the Near Future Development growth (Option 1), then a new water treatment plant will be required before the Distant Future Developments begin in order to meet the max day demands. If Water Treatment Plant 5 is constructed around Wells 12/13 in order to meet the Near Future Development growth (Option 2), the water treatment plants are projected to max out the system capacity during max day demands when the Distant Future Development growth is nearing completion. This would mean running all five treatment plants at 19 hours a day to meet the projected max day demands which is above the recommended 18 hours a day. A new water treatment plant will be required towards the tail end of development to supplement this future growth. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 IAITEt 00DNAll Due to the extra capacity provided by a water treatment plant installed at Well 12/13, a separate fee was established where the cost of constructing the water treatment plant is divided across the cumulative PE that the treatment plant can serve,which would be both the Near and Distant Future Developments. 2.6 Recommendations Based on the water distribution analysis,upgrades are needed to provide water to the Near Future Developments. The required improvements are shown on Exhibit B. Table 13 outlines the costs: TABLE 13 Water Distribution Improvement Cost Summary Option 1 Option 2/3 WTP 5 @ WTP 5 @ Cost Water Main Well 11 Well 12/13 Construction 962,500 $ 2,043,000 3,717,000 Contingency(15%) 145,000 $ 307,000 483,000 Design&Construction Engineering(15%) $195,000111 $ 307,000 483,000 TOTAL $1,302,500 $2,657,000 4,683,000 1) Design includes a flat$50,000 for a hydraulic model analysis. Constructing Water Treatment Plant 5 at Well 11 would provide an immediate benefit to the water system's redundancy on the east side of the river, and would largely be able to meet the projected demands of the Near Future Developments. However, a sixth treatment plant would likely be required soon after the full build out of the Near Future Developments. Constructing Water Treatment Plant at Wells 12 and 13 would provide a larger increase in the overall system capacity.The addition of a high capacity deep well would allow the City to handle the full growth of the Near Future Developments,and likely well into the Distant Future Developments before a sixth water treatment plant is required. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTER000MAr 3. SANITARY SEWER SYSTEM 4111.11=111=1111.111.11r—Tra"Flu 3. SANITARY SEWER SYSTEM 3.1 Existing Conditions 3.1.1 Introduction The City's existing sanitary sewer system and lift stations were analyzed to determine available reserve capacity for the future developments outlined in Table 1 in Section 1.3. This evaluation only includes the sewers and lift stations for which the future development is tributary to. Exhibit C shows the study area and trunk sewer routes. 3.1.2 Existing Trunk Sewer Analysis The capacity of the existing sanitary sewers were evaluated to determine if there is available reserve capacity for the future developments or if an upgrade is needed. To determine the reserve capacity, the annual peak flow was calculated based on the contributing population equivalents (PE) to each sewer segment. Contributing PE was determined by summing the residential and commercial PE to each sewer segment. The City's GIS sanitary sewer data included pipe size,length and inverts of the sewers which was also was used to determine the sanitary sewer capacity. The reserve capacity was determined by subtracting the peak flow from the pipe capacity. To account for infiltration and inflow,the design capacity of a sewer between 8"and 10"was calculated flowing half full and for sewers 12"and larger was calculated flowing 2/3 full. The three trunk sewer routes that were evaluated are: 1. Bull Valley Road Trunk Sewer - Starts in the Legend Lakes Subdivision located in the southwest portion of the City. The sewer discharges to the West Dartmoor and Fieldstone lift stations which then discharges to the sewer on Bull Valley Road east of Brookwood Trail. The remainder of the trunk sewer discharges by gravity to the WWTP. 2. Oaks at Irish Prairie Trunk Sewer-Starts in the Oaks at Irish Prairie Subdivision located in the southeast portion of the City. The sewer discharges to the Oaks at Irish Prairie (Doolin) Lift Station which discharges north to the sewer on Barreville Road. The sewer runs through the McHenry Shores Subdivision to the South Riverside Lift Station then to the WWTP. 3. Route 120 Trunk Sewer- Starts at the intersection of Chapel Hill Road and Route 120 and runs west along Route 120 to old Central WWTP which is now a regional pump station. Along this route there are three lift stations: Route 120,River Road and Boone Lagoon. These trunk sewer routes and tributary areas are shown on Exhibit C. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 IAATEI6OODI4All 3. SANITARY SEWER SYSTEM Page 24 3.1.3 Lift Station Analysis The City has 19 lift stations connected to their sanitary sewer distribution system to help convey wastewater to the McHenry Wastewater Treatment Plant. The lift station information is summarized in Table 14. TABLE 14 Existing Lift Stations Pump Number of Capacity Lift Station Location Pumps gpm) Type of Pump Boone Lagoon 1201 S Riverside Rd 2 1531 Constant Speed River Road 1115 River Rd 2 800 Constant Speed Route 120 2515 W Route 120 2 800 Constant Speed North Riverside 1401 N Riverside Rd 2 931 Constant Speed Hemlock 1934 Hemlock Ave 2 400 Constant Speed Diamond 3621 Diamond Dr 2 400 Constant Speed Donavan 1809 Donavan St 2 1531 Constant Speed Millstream 3710 Millstream Rd 2 400 Constant Speed Freud 3611 Freund Ave 2 400 Constant Speed Willow 4506 W Willow Ln 2 850 Constant Speed East Dartmoor 5400 Dartmoor Dr 2 400 Constant Speed Fieldstone 5809 Fieldstone Tr 3 700 Variable Speed Cartwright 501 Cartwright Tr 2 400 Constant Speed Carrick 1105 Carrick Ln 2 400 Constant Speed West Dartmoor 6400 Dartmoor Dr 2 800 Constant Speed Anne St/Grove 3805 Grove Ave 2 400 Constant Speed Doolin 1914 Doolin Rd 2 1531 Constant Speed Broadway 1016 Broadway Rd 2 400 Constant Speed South Riverside 701 S Riverside Rd 2 500 Constant Speed For the purposes of this evaluation, only the lift stations along the trunk sewer routes were evaluated to determine the reserve capacity for the future developments. These lift stations include: Bull Valley Trunk Sewer-West Dartmoor and Fieldstone Oaks at Irish Prairie Trunk Sewer-Doolin and South Riverside Route 120 Trunk Sewer-Route 120, River Road and Boone Lagoon The City provided pump run times for July 2018 to June 2019 for each lift station. The pump station capacity evaluation was based on a pump run time of 18 hours which is good planning practices so that the pump is not running 24 hours a day. The existing peak flow was calculated by multiplying the average daily flow by the IEPA peaking factor. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BARTER S!OODNAN 3. SANITARY SEWER SYSTEM Page 25 3.2 Future Demands 3.2.1 Bull Valley Trunk Sewer 3.2.1.1 Legend Lakes Development The future Legend Lakes development will be located north of Draper Road. This development is 165 acres with a density of approximately 0.6 single family households per acre which equates to 375 PE. Utilizing the IEPA peaking factor,the future peak flow from this development is 0.15 mgd. An 8" sewer stub is provided for this development on the north side of Draper Road east of Farmstead Drive(MH#6N016SN). This sewer stub connects to the sewer on Middleton Lane which ultimately discharges to the West Dartmoor Lift Station. The existing sewer between the stub at Draper Road and the West Dartmoor Lift Station has adequate capacity for the future Legend Lakes development except for the 10" sewer on Dartmoor Drive starting at Cork Lane. This is a connection point for the sewer system where the sewers north and south of Dartmoor Drive connect. The first sewer segment is a 10" pipe and does not have adequate capacity to handle the future development flow. Table 15 summarizes the capacity deficiency in this sewer. TABLE 15 Dartmoor Drive Sewer Capacity Evaluation Existing Future Sewer Down- Pipe Design Peak Peak Capacity Req'd Upstream stream Size Capacity Flow Flow Deficiency Pipe MH MH in) (mgd)mgd)mgd) mgd) Size 6O013SN 6O0175N 10 0.53 0.60 0.15 0.23 12 3.2.1.2 West Dartmoor Lift Station The future Legend Lakes development will be tributary to the West Dartmoor Lift Station. This lift station is located on Dartmoor Drive east of Cork Lane and west of Legend Lane in the Legend Lakes Subdivision. This lift station has adequate capacity handle the future wastewater flow which is outlined in Table 16 below: City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BARTER TOODMAN 3. SANITARY SEWER SYSTEM Page 26 TABLE 16 West Dartmoor Lift Station Evaluation Flow Lift Station Parameter mgd) Lift Station Firm Capacity 0.86 Existing Average Daily Flow 0.10 Existing Peak Flow 0.38 Reserve Capacity 0.48 Future Peak Flow 0.15 Remaining Reserve Capacity 0.33 This lift station discharges to a 10"force main that connects to a 12"gravity sewer on Curran Road near Eaglewood Trail. The peak velocity of the sewage in the force main should not exceed 10 fps based on good engineering design practices. The future peak velocity will be 1.5 fps,therefore this force main has adequate capacity for the future Legend Lakes development. 3.2.1.3 Preserves of Boone Creek Development The future Preserves of Boone Creek development will be located north of Bull Valley Road,west of Curran Road and south of the existing Legend Lakes Subdivision. This development is 115 acres and will be a mix of single family,multi-family and commercial. The projected PE is 1,068 which equates to a peak flow of 0.40 mgd. Two options were evaluated for connecting to the existing sanitary sewer system: (1) connect to 8" sewer stub is provided on Wicklow Drive in the Legend Lakes Subdivision and (2) connect to 12" gravity sewer on Curran Road at discharge from West Dartmoor lift station force main. 1) Connect to 8"sewer stub on Wicklow Drive:A sewer stub has been provided on Wicklow Drive which connects to the West Dartmoor lift station. This sewer is an 8"sewer until Tralee Trail where it increases to a 10"sewer to the lift station. All of the sanitary sewer segments along this route do not have adequate capacity for the future Preserves of Boone Creek development,therefore this option was no longer evaluated. 2) Connect to 12" sewer on Curran Road: The West Dartmoor Lift Station force main discharges to this 12"sewer on Curran Road which then goes through the Boone Creek Subdivision on Eaglewood Trail then to the Fieldstone Lift Station. This sewer is a 12" until Fieldstone Trail where it increases to a 15"sewer to the lift station. For this option, the future Legend Lakes,Preserves of Boone Creek and Legend Lakes Part 2 (see Section 3.2.1.4 below) developments are tributary to this sewer. The total future peak flow is 0.78 mgd. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 IA1TEIIOODMAN 3.2.1.4 Legend Lakes Part 2 Development The future Legend Lakes Part 2 development will be located east of Curran Road and north of Bull Valley Road. This development is mix of single and multi-family homes with a projected PE of 756. The future peak flow from this development is 0.29 mgd. This development will connect to the 12" sewer on Curran Road where the West Dartmoor Lift Station discharges which will also include flow for the future Legend Lakes and Preserves of Boone Creek developments. The total future peak flow from these developments will be 0.78 mgd. There are two sewer segments on Eaglewood Trail that do not have adequate capacity for these future developments. Also there is one sewer segment of the 15"sewer on Fieldstone Trail does not have adequate capacity. These sewers do not have capacity due to the shallow slope of the pipe compared to the other pipes of the same size. Table 17 summarizes the capacity deficiencies in this sewer. The remaining sewers along this route to the Fieldstone Lift Station have adequate capacity. TABLE 17 Eaglewood,Newport&Fieldstone Sewer Capacity Evaluation Existing Future Sewer Req'd Down- Pipe Design Peak Peak Capacity Pipe Upstream stream Size Capacity Flow Flow Deficiency Size MH MH Street (in) (mgd) (mgd) (mgd) (mgd)in) 7P007SN 7P006SN Eaglewood 12 0.55 0.43 0.78 0.66 15 7P029SN 7P031SN Eaglewood 12 0.60 0.49 0.78 0.67 15 7P023SN 7P024SN Fieldstone 15 1.27 0.88 0.78 0.38 18 3.2.1.5 Fieldstone Lift Station The Fieldstone Lift Station is located on Fieldstone Trail in the Boone Creek Subdivision. It is a triplex, submersible station with 700 gpm variable speed pumps. This station was recently upgraded by the City and has adequate capacity for future developments, therefore further evaluation of this lift station was not done. 3.2.1.6 Bull Valley Trunk Sewer The Fieldstone Lift Station discharges to a 15"gravity sewer on Bull Valley Road east of Brookwood Trail. The remainder of this sanitary trunk sewer to the WWTP is all gravity sewer. The pipe size increases to a 24" sewer at Bull Valley Road and Cunat Drive then finally to a 30" sewer when it starts heading north of Bull Valley Road(east of Ridgeview Drive). A large majority of the trunk sewer has adequate capacity. There are two sewer segments on Bull Valley Road that do not have adequate capacity due to the shallow slope of the sewer. Table 18 below summarizes the deficiencies. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 AETEOODMA• 3. SANITARY SEWER SYSTEM Page 28 TABLE 18 Bull Valley Road Sewer Capacity Evaluation Existing Future Sewer Req'd Down- Pipe Design Peak Peak Capacity Pipe Upstream stream Size Capacity Flow Flow Deficiency Size MH MH in) (mgd)mgd) (mgd) mgd) in) 8P006SN 8P009SN 15 1.49 1.07 0.78 0.36 18 9S006SN 9S005SN 24 0.92 1.07 0.78 0.93 36 3.2.2 Oaks at Irish Prairie Trunk Sewer 3.2.2.1 Oaks at Irish Prairie Development The future Oaks at Irish Prairie development will be located north of Veterans Parkway and east of Barreville Road. This development is 75 acres with a density of 2.7 single family households per acre which equates to 700 PE. The future peak flow from this development is 0.27 mgd. Two sewer stubs have been provided on Veterans Parkway for this development. One is located at Doolin Avenue and the other at Charmar Lane. For the basis of our evaluation, the flow from the future development was split equally to these two connection points. Both sewer routes ultimately connect to the Doolin Lift Station. All of these sanitary sewers have adequate capacity for the future Oaks at Irish Prairie development. 3.2.2.2 Doolin Lift Station The future Oaks at Irish Prairie development will be tributary to the Doolin Lift Station that is located on Doolin Road in the Oaks at Irish Prairie Subdivision. This lift station has adequate capacity handle the future wastewater flow which is outlined in Table 19: TABLE 19 Doolin Lift Station Evaluation Lift Station Parameter Flow(mgd) Lift Station Firm Capacity 1.65 Existing Average Daily Flow 0.16 Existing Peak Flow 0.59 Reserve Capacity 1.06 Future Peak Flow' 0.56 Remaining Reserve Capacity 0.53 1 An additional 0.29 mgd has been added to the future peak flow for the undeveloped residential lots in the current Oaks at Irish Prairie subdivision and undeveloped commercial lots. This lift station discharges to a 8"force main that connects to a 12"gravity sewer on Barreville Road near Forest Road. The future peak velocity in the force main will be 5.9 fps which is below the 10 fps threshold therefore this force main has adequate capacity for the future development. City of McHenry,Illinois 2019 Capital Development Fee Study•190382.30 BAXTER,400DMAN 3.2.2.3 Oaks at Irish Prairie Trunk Sewer(McHenry Shores Subdivision) The Doolin Lift Station discharges to a 12"gravity sewer on Barreville Road near Forest Road which conveys the wastewater through the McHenry Shores Subdivision to the South Riverside Lift Station. The sewer increases to a 15"at Barreville Road and Beach Drive then to an 18"sewer at Beach Drive and South Broadway Street. There are two sewer segments along the existing 12" sewer on Barreville Road that do not have adequate capacity for the future development. Also there is a segment of 18"on Pearl Avenue that does not have adequate capacity due to a shallow slope. Table 20 summarizes the deficiency. TABLE 20 Barreville Road&Pearl Avenue Sewer Capacity Evaluation Existing Future Sewer Req'd Down- Pipe Design Peak Peak Capacity Pipe Upstream stream Size Capacity Flowl Flow Deficiency Size MH MH Street (in) (mgd) (mgd) (mgd) (mgd)in) 11U019SN 11U018SN Barreville 12 0.60 0.79 0.27 0.47 15 11U018SN 11U017SN Barreville 12 0.41 0.73 0.27 0.65 15 12T001SN 12S028SN Pearl 18 090 1.36 0.27 0.73 21 1An additional 0.29 mgd is included in the existing peak flow in this table for the undeveloped residential lots in the current Oaks at Irish Prairie subdivision and undeveloped commercial lots. 3.2.2.4 South Riverside Lift Station The future Oaks at Irish Prairie development will also be tributary to the South Riverside Lift Station that is located at the north end of South Riverside Drive in the McHenry Shores Subdivision. The South Riverside Lift Station does not have adequate capacity to handle the future flow from the Oaks at Irish Prairie development which is outlined in Table 21. TABLE 21 South Riverside Lift Station Evaluation Lift Station Parameter Flow mgd) Lift Station Firm Capacity 0.54 Existing Average Daily Flow 0.12 Existing Peak Flow 0.46 Reserve Capacity 0.08 Future Peak Flow 0.56 Remaining Reserve Capacity 0.48 Required Pump Upgrade 2 pumps @ 1,000 gpm each City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTE 00DMAN This lift station discharges to a 10"force main that connects to the McHenry Wastewater Treatment Plant. The future peak velocity in the force main will be 2.0 fps which is below the 10 fps threshold therefore this force main has adequate capacity for the future development. 3.2.3 Route 120 Trunk Sewer 3.2.3.1 Future Developments at Route 120&Chapel Hill Road Future developments at the southeast and southwest corners of Route 120 and Chapel Hill Road will be a mix of single family homes and commercial development. These developments will add 1,584 PE which equates to a future peak flow of 0.58 mgd. These developments will discharge to the existing 12"sanitary sewer on Route 120 which discharges to the Route 120 Lift Station. The existing flow tributary to the Route 120 trunk sewer is from non-residential businesses. The existing peak flow at the Route 120 Lift Station is 0.10 mgd. This flow was used as the existing peak flow in the trunk sewer. The existing 12" sewer on Route 120 has adequate capacity to convey the flow from the future developments and the existing flow at the Route 120 Lift Station. 3.2.3.2 Route 120 Lift Station The future developments at the intersection of Route 120 and Chapel Hill Road will be tributary to the Route 120 Lift Station which is located on Route 120 between Adams Drive and Hillside Lane. This lift station has adequate capacity for the future developments which is outlined in Table 22. TABLE 22 Route 120 Lift Station Evaluation Flow Lift Station Parameter mgd) Lift Station Firm Capacity 1.01 Existing Average Daily Flow 0.02 Existing Peak Flow 0.10 Reserve Capacity 0.91 Future Peak Flow 0.58 Remaining Reserve Capacity 0.33 This lift station discharges to a 6"force main that connects to a 12"gravity sewer on Route 120.The future peak velocity in the force main will be 5.3 fps which is below the 10 fps threshold therefore this force main has adequate capacity for the future developments. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 IAETER6 OODMA 3. SANITARY SEWER SYSTEM Page 31 3.2.3.3 Route 120 Trunk Sewer between Route 120 &River Road Lift Stations The 12" sanitary sewer continues west along Route 120 until Northside Avenue where is starts to meander along side streets south of Route 120 to the River Road Lift Station. There are two trunk sewers that discharge to the River Road Lift Station. It was estimated that about 25% of the flow is coming from the Route 120 trunk sewer. There are three sewer segments that do not have adequate capacity to handle the future peak flow due to a shallow slope, therefore these sewer segments will require to be upgraded. These sewer segments are located in a parking lot south of Route 120 and east of Charles Street. Table 23 summarizes the deficiencies. TABLE 23 Route 120 Sewer Capacity Evaluation to River Road Lift Station Existing Future Sewer Req'd Down- Pipe Design Peak Peak Capacity Pipe Upstream stream Size Capacity Flow Flow Deficiency Size MH MH in) (mgd)mgd) (mgd) mgd) in) 13L018SN 13L016SN 12 0.43 0.23 0.86 0.11 15 13L016SN 13L017SN 12 0.38 0.23 0.86 0.20 15 13L017SN 13L015SN 12 0.38 0.23 0.86 0.20 15 3.2.3.4 River Road Lift Station The future developments at the intersection of Route 120 and Chapel Hill Road will be tributary to the River Road Lift Station which is located on River Road south of Route 120. This lift station does not have adequate capacity to handle the future flow from the future developments at Route 120 and Chapel Hill Road which is outlined in Table 24. TABLE 24 River Road Lift Station Evaluation Flow Lift Station Parameter mgd) Lift Station Firm Capacity 0.86 Existing Average Daily Flow 0.14 Existing Peak Flow 0.52 Reserve Capacity 0.35 Future Peak Flow 0.58 Remaining Reserve Capacity 0.23 Required Pump Upgrade 2 pumps @ 1,100 gpm each City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTER``r,WOODNAN This station discharges to a 6"force main that connects to a 12"gravity sewer on Riverside Avenue. The future peak velocity in the force main will be 8.6 fps which is below the 10 fps threshold therefore this force main has adequate capacity for the future developments. 3.2.3.5 Route 120 Trunk Sewer between River Road&Boone Lagoon Lift Stations The River Road Lift Station discharges to a 12"sanitary sewer which then increases to a 24"pipe at Riverside Drive where the North Riverside Lift Station connects. The 24" sewer connects to the Boone Lagoon Lift Station. Both these sewers have adequate capacity for the future developments. 3.2.3.6 Boone Lagoon Lift Station The future developments at the intersection of Route 120 and Chapel Hill Road will be tributary to the Boone Lagoon Lift Station which is located on Riverside Avenue south of Venice Avenue. This lift station does not have adequate capacity to handle the future flow from the future developments at Route 120 and Chapel Hill Road which is outlined in Table 25. TABLE 25 Boone Lagoon Lift Station Evaluation Flow Lift Station Parameter mgd) Lift Station Firm Capacity 1.65 Existing Average Daily Flow 0.47 Existing Peak Flow 1.55 Reserve Capacity 0.11 Future Peak Flow 0.58 Remaining Reserve Capacity 0.47 Required Pump Upgrade 2 pumps @ 2,300 gpm each The Freund Lift Station currently discharges to the Boone Lagoon Lift Station. The City is currently discussing the possibility of diverting the Freund Lift Station to the Millstream Lift Station which would provide additional capacity at the Boone Lagoon Lift Station. Based on July 2018 to June 2019 pump run time data,the peak flow at the Freund Lift Station is 0.66 mgd. The proposed future peak flow from the new developments at Route 120 and Chapel Hill Road is 0.58 mgd, therefore if the Freund Lift Station is diverted to the Millstream Lift Station then no upgrades would be required at the Boone Lagoon Lift Station. This station discharges to a 10" force main that connects to the old Central WWTP which is now a regional pumping station. The regional pumping station then pumps the wastewater to the McHenry WWTP.The future peak velocity in the force main will be 6.0 fps which is below the 10 fps threshold therefore this force main has adequate capacity for the future developments. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTER WOODMAN 3. SANITARY SEWER SYSTEM Page 33 3.3 Recommendations Based on the sanitary sewer and lift station capacity analysis,upgrades are needed to accommodate the peak wastewater flow from the future developments. The total cost for all sanitary sewer and lift station improvements is$3,055,000. Table 26 outlines the costs by trunk sewer route. TABLE 26 Trunk Sewer&Lift Station Cost Oaks at Irish Cost Bull Valley Prairie Route 120 Sanitary Sewer 465,500 163,275 58,800 Lift Station 475,000 1,100,000 Subtotal 465,500 638,275 1,158,800 Contingency(20%) 93,000 127,675 231,800 Design&Construction Engineering(15%) 69,800 95,750 173,800 628,300 861,700 1,564,400 TOTAL 3,055,000 If the City decides to divert the Freund Lift Station flow to the Millstream Lift Station,then the total cost for all the sanitary sewer and lift station improvements is $2,245,000. Table 27 outlines the costs by trunk sewer route for this option. TABLE 27 Trunk Sewer&Lift Station Cost with Freund Lift Station Diversion Oaks at Irish Cost Bull Valley Prairie Route 120 Sanitary Sewer 465,500 163,275 58,800 Lift Station 475,000 500,000 Subtotal 465,500 638,275 558,800 Contingency(20%) 93,000 127,675 111,800 Design&Construction Engineering(15%) 69,800 95,750 83,800 628,300 861,700 754,400 TOTAL 2,245,000 City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAITER ,WOODMAN 4. WASTEWATER SYSTEM 4.1 Existing Conditions 4.1.1 Background Prior to January 2018,the City of McHenry owned and operated two wastewater treatment plants: the Central Wastewater Treatment Plant and the South Wastewater Treatment Plant. The Central Wastewater Treatment Plant is located at 3308 Waukegan Road, and was designed for a daily average flow of 3.0 MGD.The South Wastewater Treatment Plant is located just west of the Fox River at 3200 Charles J.Miller Road,and was designed for a daily average flow of 1.5 MGD. The City completed its wastewater consolidation program in January 2018,which transformed the Central Wastewater Plant into the Regional Booster Pumping Station and upgraded the South Wastewater Treatment Plant to handle the City's total loads. The renamed McHenry Wastewater Treatment Plant was permitted for 4.0 MGD Design Average Flow(DAF) and 16.0 MGD Design Max Flow(DMF),which is a net loss of 0.5 MGD from the pre-consolidation status. 4.1.2 McHenry WWTP&Regional Pump Station The McHenry WWTP can be described as having two treatment processes during average flow conditions,the liquid steam and the solids stream treatment.The liquid stream treatment consists of primary, secondary and tertiary treatment with UV disinfection. The solids stream treatment consists of thickening, partial digestion ,and dewatering of the produced/removed solids from the liquid stream treatment process. Primary treatment removes coarse solids though a step screen, fine solids and grit are removed by proceeding micro-screens. Secondary treatment degrades organic matter and settles suspended solids that were not removed during primary treatment. Organic matter is degraded through a biological process that takes place in a sequence batch reactor and two oxidation ditches.The liquid then goes through secondary clarification where the smaller particle solids are settled and removed. Tertiary treatment polishes secondary effluent by further removal of suspended solids and further reduction of organic concentrations. Finally, the polished effluent passes through UV disinfection where pathogenic organisms are inactivated, allowing for clean and safe water discharge.Plant effluent is discharged directly into the Fox River,which is a tributary to the Illinois River. Thickening,of the secondary produced sludge,is accomplished by a gravity belt thickener to increase the percent solids concentration of the sludge. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 IAXTE116q00DMA Partial digestion takes place in an aerated sludge holding tank that where sludge is stabilized through a biological process targeting reduction of odor, and pathogen concentration. Dewatering is accomplished by passing the partially digested sludge through two belt filter presses which dewater and thicken sludge to approximately 15-20%solids.The dry sludge is then sent to hauling trucks that take the dry sludge to the Winnebago landfill in Rockford. During max flow conditions,triggered by a significant storm event,the process is modified to be able to handle a design max flow of 16 MGD. In such conditions a high-rate clarifier unit is brought on line for additional secondary treatment capacity. The McHenry Wastewater Treatment Plant received its new NPDES Permit effective November 1, 2015 with an expected expiration date of October 31,2020.A copy of the current NPDES permit and supplemental conditions for the treatment plant is included in Appendix E. The permitted limit requirements are listed in Table 28. TABLE 28 NPDES Permit Effluent Limit Requirements Parameter Limit Monthly Avg CBOD 20 mg/L Monthly Avg TSS 25 mg/L Daily Minimum Dissolved Oxygen March-July 5.0 mg/L Aug-Feb 3.5 mg/L Monthly Avg Phosphorus 1.0 mg/L Monthly Avg Ammonia-Nitrogen March-Oct 1.5 mg/L The Regional Booster Pumping Station collects flow that was originally treated at the Central Wastewater Treatment Plant and sends it to the McHenry WWTP through a 16 inch force main.The pump station contains two pumps for a combined max capacity of 4.2 MGD that send the regular regional discharge to the WWTP. There are two additional storm pumps that activate during a storm mode",which sends the water through a dedicated 24 inch force main to the treatment plant. 4.2 Future Demands WWTP capacity is important to consider because each process in the plant has been designed to handle so much flow in order to properly treat wastewater to meet NPDES discharge limits.When applying for a new NPDES permit,IEPA examines the percent of total capacity WWTP is rated for. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAETER6COODNAll Determining future capacity of a wastewater treatment plant considers the, hydraulic loading, organic loading, and total solids loading the plant is expected to have. Loading projections are estimated based on the 10 States Standards listed projection factors 100 gpd/PE, 0.17 lbs.BOD/PE, and 0.20 lbs.TSS/PE respectively.The 10 States Standards are an industry accepted set of standards widely used in the Midwest region of the United States. 4.2.1 Near Future Wastewater capacity in Near Future conditions were examined by computing plant capacity respective to the added flow from the three trunk sewers identified in Section 3 of the report. Bull Valley Road Trunk Sewer will add flow from the Legend Lakes,Preserves of Boone Creek, and Bull Valley& Curran developments. The additional 2,298 P.E will add 0.23 MGD,which will increase hydraulic loading to 3.33 MGD and cause plant to be at 83%of total plant capacity. Oaks at Irish Prairie Trunk Sewer will add flow only from the Oaks at Irish Prairie development.The additional 700 P.E will add 0.07 MGD, which will increase hydraulic loading to 3.17 MGD and cause plant to be at 79%of total plant capacity. Route 120 Trunk Sewer will add flow from East and West of Chapel Hill Road developments.The additional 1,584 P.E will add 0.16 MGD,which will increase hydraulic loading to 3.26 MGD and cause plant to be at 82%of total capacity. Assuming all Near Future Developments, the additional 4,582 P.E will add 0.46 MGD, which will increase hydraulic loading to 3.56 MGD and cause plant to be at approximately 89%of total capacity. Table 29 summarizes the respective evaluation for Near Future conditions. TABLE 29 Hydraulic Load Projection Oak at Irish Bull Valley Rd. Prairie Route 120 All Near Trunk Sewer Trunk Sewer Trunk Sewer Future Additional Total P.E 2,298 700 1,584 4,582 Flow Factor 100 100 100 100 gpd/P.E) Additional flow 229,800 70,000 158,360 458,160 gpd) Additional flow 0.23 0.07 16 0.46 MGD) Existing hydraulic load 3.10 3.10 3.10 3.10 MGD) City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTER WOODMAN 4. WASTEWATER SYSTEM Page 37 Oak at Irish Bull Valley Rd. Prairie Route 120 All Near Trunk Sewer Trunk Sewer Trunk Sewer Future Near Future Hydraulic 3.33 3.17 3.26 3.56Loading(MGD) 4.00 4.00 4.00 4.00 Existing Plant Capacity Percent of Total Plant 83%79% 82% 89% Capacity Future organic and total solids loadings were examined similarly. The wastewater treatment plant has design loadings of 7,206 lbs. BOD/day and 7,907 lbs. TSS/day. Loading projections for both parameters remain at or under 70%of total design capacity with all Near Future Developments. Tables 30 and 31 summarize the added organic and solids load and the respective percent of total design capacity. TABLE 30 Organic Load Projection Oak at Irish Bull Valley Rd Prairie Route 120 All Near Trunk Sewer Trunk Sewer Trunk Sewer Future Additional total P.E 2,298 700 1,584 4,582 Organic contribution factor 0.17 0.17 0.17 0.17 lbs.BOD5/PE) Additional organic load 390 119 269 779 lbs. BODS/day) Existing organic Loading 4,213 4,213 4,213 4,213 lbs. BODS/day) Total organic loading 4,603 4,332 4,482 4,992lbs. BOD5/day) Organic design loading 7,206 7,206 7,206 7,206 lbs. BODS/day) of Organic loading 64% 60%62% 69% capacity City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTER WOODMAN 4. WASTEWATER SYSTEM Page 38 TABLE 31 Solids Load Projection Oak at Irish Bull Valley Rd Prairie Route 120 All Near Trunk Sewer Trunk Sewer Trunk Sewer Future Additional Total PE 2,298 700 1,584 4,582 Total solids contribution factor 0.20 0.20 0.20 0.20 lbs.TSS/PE) Additional SS Load 460 140 317 916lbs.TSS/day) Existing total solids loading 4,228 4,228 4,228 4,228 lbs.TSS/day) Total solids loading, 4,688 4,368 4,545 5,145lbs.TSS/day) Total solids design loading 7,907 7,907 7,907 7,907 lbs.TSS/day) of Total solids loading 59% 55%57% 65% capacity Organic and solids loading projections remain at or under 65%of total capacity with all Near Future developments contributing flow to McHenry WWTP. 4.2.2 Distant Future Distant Future Developments are presumed to be developed after all Near Future Developments. There are four identified Distant Future developments for which wastewater treatment plant capacity was examined. All Distant Future Developments will add flow from South of Bull Valley& Curran, East of Crystal Lake Road, North of McCullum Lake Road, 120 & Martin Road, and Chapel Hill Road north of 120. The additional 10,540 P.E will add 1.05 MGD,which will increase hydraulic loading to 4.62 MGD and cause plant to be 15% over the hydraulic capacity. Table 32 below summarizes the respective hydraulic capacity evaluation for Distant Future. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTERNVIOODMAN 4. WASTEWATER SYSTEM Page 39 TABLE 32 Distant Future Hydraulic Load Projections Chapel South of East of North 120& Hill Road All Bull Valley Crystal Lake McCullom Martin (north of Distant Curran Road Lake Road Road 120) Future Additional Total P.E 1,701 4,583 3,166 898 193 10,540 Flow Factor gpd/P.E) 100 100 100 100 100 100 Additional flow gpd)170,100 458,300 316,600 89,800 19,300 105,4000 Additional flow MGD) 0.17 0.46 0.32 0.09 0.02 1.05 Existing hydraulic load MGD) 3.56 3.56 3.56 3.56 3.56 3.56 Distant Future hydraulic load 3.73 4.02 3.88 3.65 3.58 4.62 MGD) Existing Plant Capacity 4.00 4.00 4.00 4.00 4.00 4.00 MGD) Percent of Total 93% 101% 97% 91%90% 115%Plant Capacity The organic and total solids loading projections were evaluated at Distant Future conditions as well. The loadings with all Distant Future Developments remained under 92%, and 88% respectively. These loadings are not of significance since the limiting factor for the plant is the hydraulic load, with all Distant Future Developments the hydraulic load exceeds capacity by 15%. 4.3 Recommendations 4.3.1 NPDES Plant Re-Rating Re-rating McHenry WWTP from 4.0 MGD to 4.5 MGD has been examined as a possible solution. The City can approach a re-rate now or approach at a future date within the next ten years. In order to achieve a re-rate from IEPA McHenry must: 1) Provide information required by IEPA to conduct a new Anti-Degradation Analysis 2) Prove the McHenry WWTP has 4.5 MGD of capacity through a Basis of Design showing that each treatment process has the capacity to justify a re-rate. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTER WOODMAN Approaching a re-rate now would require the two things mentioned above to be submitted to IEPA for approval.Based on the evaluation for Potential and Distant Future Developments,hydraulic load was pointed as the limiting factor of the plant.With this being said, the City would approach a re- rate to 4.5 MGD and agree to keep load limits as if it was rated for 4 MGD. Table 33 depicts the max concentration load to meet if a re-rate to 4.5 MGD is approached keeping 4.0 MGD load limits. TABLE 33 Max Concentration to Meet Load Limit at a 4.5 MGD Re-Rate BODS SS NH3 TP Permitted Flow 4.0 4.0 4.0 4.0MGD) Concentration Limit 20 25 1.5 1 mg/L) Conversion Factor 8.34 8.34 8.34 8.34 lb.-L/mg-MG) Load Limit lbs/day) 667 834 50 33 Load Limit lbs./day) 667 834 50 33 Re Rate 4.5 4.5 4.5 4.5 MGD) Conversion Factor 8.34 8.34 8.34 8.34 lb.-L/mg-MG) Max Concentration to meet Load Limit at re-rated flow of 4.5MGD 17.8 22.2 1.3 0.9 mg/L) Re-rating at a future date is another option. At this point in time there is no immediate need to provide the plant with additional capacity. Currently, the plant is at 73% of its total hydraulic capacity and is projected to have sufficient capacity for all Near Future Developments expected in the next twenty years. Planning for a re-rate together with the Facility Plan Report at a future date will give the City planning time to prepare for those identified Distant Future Developments. Incorporating the cost to re-rate to the capital development fee will provide funds specifically allocated for this purpose.It is also important to mention that requirements to re-rate in the future are bound to change. Table 34 below compares advantages and disadvantages. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAIT EI OODMAII 4. WASTEWATER SYSTEM Page 41 TABLE 34 Re-Rate Now Versus at a Future Date Comparison Advantages Disadvantages Gives security for the next 20 years Immediate Cost Re-Rate Now Avoid request changes from Development Fee Increase Environmental Advocacy Groups Reduction in Capital Environmental AdvocacyDevelopmentFee Groups could add more Re Rate at a Provides City with planning time onerous request Future Date Provides City with time to Changes in EPA limits and allocate funds procedures 4.3.2 Addressing Infiltration and Inflow Infiltration and Inflow(I/I) is additional flow wastewater plants receive via sanitary sewer. Inflow refers to water from improper connections,such as downspouts or sump pumps.Infiltration refers to groundwater entering the sewer pipe through leaks.A focus to decrease I/I would entail making upgrades to the City's sanitary sewer system. Such upgrades will assist in the hydraulic load reduction to the treatment plant. The most recent NPDES permit evaluation for the McHenry WWTP, noted that the City has been actively using a televising system to identify and repair lines as needed.It was also pointed out that the City budgets$100K per year for sewer lining.The City is expecting an update to their SSES model in the near future,the latest update to the report was completed in 2008. 4.3.3 Wastewater Capacity Discussion Section 4.3 discusses possible solutions with a target to provide the wastewater treatment plant with sufficient capacity to service all Near Future and Distant Future Developments. The plant is projected to have sufficient capacity for all Near Future Developments but for Distant Future, assuming all Near Future are developed first,the plant is projected to be 15%over its rated capacity. Table 35 below summarizes the projected loadings and respective percent of total capacity for each parameter evaluated. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTER WOODMAN 4. WASTEWATER SYSTEM Page 42 TABLE 35 Wastewater Capacity Summary Table Near Future Distant Future Near Future+Distant Existing Development Development Future Developments Loading % of Capacity Loading %of Capacity Loading % of Capacity Loading % of Capacity Hydraulic MGD) 3.10 78% 3.56 89.07% 4.15 104% 4.62 115% Organic lbs. BOD/day) 4,206 58% 4992 69% 5,998 83% 6,777 92% Total Solids lbs. TSS/day) 4,222 53% 5,145 65% 6,330 80% 7,246 88% As there is no immediate need to re-rate the plant,approaching a re-rate at a future date is identified as the option with least impact to the development fee. The cost to re-rate would include a Facility Plan Report, and allocated budget to meet with local Environmental Advocacy groups.The present value of a Facility Plan Report accounting for meetings is estimated to be$100,000.Inflating at a 4%rate to ten years from now,the estimated future cost will be approximately$148,00,00. Inflation records from Engineering News Record Construction Cost Index for Chicago were used to calculate the 4% inflation rate. Records show that the ENR CCI has increased an average of 4.15% per year from December of 1993 to July of 2019,for the purpose of this report the rate was rounded to the nearest percent value. It is ultimately up to the City to decide which option it is most appropriate. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTER WOODMAN 5. CAPITAL DEVELOPMENT FEE Page 43 5. CAPITAL DEVELOPMENT FEE 5.1 Existing Capital Development Fee The City of McHenry's existing water and sanitary sewer development fees effective on May 1, 2016 are summarized in Table 36. TABLE 36 Existing Residential Water&Sewer Capital Development Fee Structure Connection to Connection to Connection to Both Type of Unit Water Only Sewer Only Water&Sewer Detached Single-Family 2 Bedroom or less 2,199 2,607 4,806 3 Bedroom 3,811 3,739 7,550 4 Bedroom 4,098 4,788 8,886 5 Bedroom or more 4,098 4,868 8,966 Attached Single-Family 1 Bedroom 1,300 1,538 2,838 2 Bedroom 2,164 2,571 4,735 3 Bedroom 2,602 3,151 5,753 4 Bedroom or more 3,426 4,057 7,483 Apartments Efficiency 1,408 1,674 3,082 1 Bedroom 1,912 2,273 4,185 2 Bedroom 2,084 2,471 4,555 3 Bedroom 3,325 3,942 7,267 Connection to Connection to Connection to Both Meter Size Water Only Sewer Only Water&Sewer 3/ 4' 3,811 3,739 7,550 1" 10,655 6,252 16,917 11/z" 18,288 12,462 30,750 2" 30,478 19,942 50,420 3" 68,578 39,924 108,502 4" 190,492 62,377 252,869 6" 190,492 124,712 315,204 City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAETER ;'IIIOODMA6 5. CAPITAL DEVELOPMENT FEE Page 44 5.2 Water Capital Development Fee Three options were evaluated for the water capital development fee: 1) Build Water Treatment Plant 5 at Well 11 2) Build Water Treatment Plant 5 at Well 12/13 and spread cost over Near Future PE 3) Build Water Treatment Plant 5 at Well 12/13 and spread cost over Near and Distant Future PE The cost per household to construct the required water system improvements are shown in Table 37 below. TABLE 37 Water System Capacity Improvement Costs per Average Household Cost per Options Household 1 -Water Treatment Plant 5 at Well 11 2,590 2 -Water Treatment Plant 5 at Well 12/13 (Near Future PE)3,920 3 -Water Treatment Plant 5 at Well 12/13 (Distant Future PE) 1,120 Table 38 provides the following capital development fee structure for residential units for both options. TABLE 38 Residential Water Capital Development Fee Structure Option 3 Option 2 Wells 12/13 Total Person Option 1 Wells 12/13 Distant Future Type of Unit per Dwelling Unit Well 11 (Near Future PE) PE) Detached Single-Family 2 Bedroom 2.017 1,899 2,870 819 3 Bedroom 2.899 2,729 4,125 1,177 4 Bedroom 3.764 3,543 5,356 1,528 5 Bedroom 3.770 3,549 5,364 1,530 Attached Single-Family 1 Bedroom 1.193 1,123 1,698 484 2 Bedroom 1.990 1,873 2,832 808 3 Bedroom 2.392 2,252 3,404 971 4 Bedroom 3.145 2,960 4,475 1,276 Apartments City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTER •WOODMAN 5. CAPITAL DEVELOPMENT FEE Page 45 Efficiency 1.294 1,218 1,842 525 1 Bedroom 1.758 1,655 2,502 714 2 Bedroom 1.914 1,802 2,724 777 3 Bedroom 3.053 2,874 4,344 1,239 The City's capital development fee system for commercial and industrial users assesses fees based on the size of the water meter installed,which is shown below in Table 39. TABLE 39 Commercial and Industrial Water Capital Development Fee Structure Option 2 Option 3 Option 1 Wells 12/13 Wells 12/13 Meter Size Capacity Ratio Well 11 (Near Future PE) (Distant Future PE) 5/8"x 3/4" 1.00 2,590 3,920 1,120 1"2.80 7,252 10,976 3,136 1-1/2" 4.80 12,432 18,816 5,376 2"8.00 20,720 31,360 8,960 3" 18 46,620 70,560 20,160 4" 50 129,500 196,000 56,000 6" 50 129,500 196,000 56,000 8"180 466,200 705,600 201,600 Table 40 provides a comparison between the existing and proposed costs for a 3 bedroom detached single family home: TABLE 40 Existing&Proposed Water Capital Development Comparison Option 1 Option 2 Option 3 Existing Proposed Proposed Proposed Type of Unit Water Fee Water Fee Water Fee Water Fee Detached Single-Family 3 Bedroom 3,811 2,729 4,125 1,177 Increase 28% 8% 69% For the purpose of this report and given the fact that there is a still a Distant Future development category, Baxter and Woodman would recommend Option 2. This option gets all the wells at a comfortable max daily runtime,all very well under the recommended max of 18 hours per day.This leave the City is a good position in the event development occurs more quickly than anticipated as well as provided a larger firm capacity to the entire system. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTERR +WOODMAN 5. CAPITAL DEVELOPMENT FEE Page 46 5.3 Sanitary Sewer Capital Development Fee The Sewer Capital Development Fee is comprised of the capacity improvement upgrades required in both the collection and conveyance of sewage and the treatment process. Two options were evaluated: 1) Fee based on sanitary sewer improvements with current lift station configuration. 2) Fee based on sanitary sewer improvements if the Freund Lift Station is diverted to the Millstream Lift Station. Table 41 summarizes the cost per household for the required improvements. TABLE 41 Sewer Capital Development Fee for Average Household Cost per Household Option 1 Option 2 Sanitary Sewer Capacity Improvements 1,834 1,348 Wastewater Capacity Improvements 89 89 Sewer Capital Development Fee 1,923 1,437 The City's current capital development fee structure for residential units is based on the Table of Estimated Ultimate School Population Per Dwelling Unit from the 1996 Illinois School Consulting Service,Associated Municipal Consultants,Inc., Naperville, Illinois.The published figures were used to establish the respective population densities per type of residential unit. Table 42 provides the following capital development fee structure for residential units. TABLE 42 Residential Sewer Capital Development Fee Structure Option 1 Option 2 Total Person per Capital Capital Type of Unit Dwelling Unit Development Fee Development Fee Detached Single-Family 2 Bedroom 2.017 1,410 1,053 3 Bedroom 2.899 2,027 1,514 4 Bedroom 3.764 2,631 1,966 5 Bedroom 3.770 2,635 1,969 Attached Single-Family 1 Bedroom 1.193 834 623 City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTER,'-,WOODMAN 5. CAPITAL DEVELOPMENT FEE Page 47 Option 1 Option 2 Total Person per Capital Capital Type of Unit Dwelling Unit Development Fee Development Fee 2 Bedroom 1.990 1,391 1,039 3 Bedroom 2.392 1,672 1,249 4 Bedroom 3.145 2,198 1,643 Apartments Efficiency 1.294 905 676 1 Bedroom 1.758 1,229 918 2 Bedroom 1.914 1,338 1,000 3 Bedroom 3.053 2,134 1,594 Table 43 provides the capital development fee structure for commercial and industrial units based on meter size. TABLE 43 Commercial and Industrial Capital Fee Structure Option 1 Option 2 Sewer Capital Sewer Capital Meter Size Capacity Ratio Development Fee Development Fee 5/8"x 3/4" 1.00 1,923 1,437 1" 2.80 5,384 4,024 1-1/2" 4.80 9,230 6,898 2" 8.00 15,384 11,496 3" 18 34,614 25,866 4" 50 96,150 71,850 6" 50 96,150 71,850 8" 180 346,140 258,660 Table 44 provides a comparison between the existing and proposed costs for a 3 bedroom detached single family home: TABLE 44 Existing&Proposed Sewer Capital Development Comparison Option 1 Option 2 Existing Proposed Proposed Type of Unit Sewer Fee Sewer Fee Sewer Fee Detached Single-Family 3 Bedroom 3,739 2,027 1,514 Increase 46% 60% City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTER '=WOODMAN 5.4 Comparison of Neighboring Development Fees A survey of neighboring and similar communities' development fees was conducted as part of this study.The survey required minor assumptions to compare development(connection)fee structures that do not match McHenry's existing fee structure. The results for the Water and Sanitary Sewer Development Fees are shown in Appendix C and D. Overall, the existing Residential Water Development Fees for McHenry rank the lowest in comparison to the Village of Algonquin, Village of Cary, City of Crystal Lake, Village of Lakewood, Village of Lake in the Hills, and the City of Woodstock. McHenry's existing Residential Water Connection fee comes in at $2,199 for the base unit of a Detached Single-Family home with two bedrooms.The Village of Lakewood's fee for an equivalent unit is$10,766. In comparison,the most costly option of proceeding with the construction of Water Treatment Plant 5 at Wells 12/13 over the Near Future PE Projection, McHenry's water development fees rank 2nd out of the group at 2,870 for the base unit. Non-Residential Water Development Fees for McHenry rank fairly high on the whole compared to the figures available for comparison among the communities listed above. It should be noted that the capacity ratio between meters appears to be unequal between each municipality,and causes the larger meters to be more costly within McHenry. Capacity ratios roughly equate how much more water would pass through a given meter size,with the base ratio starting at a 3/4-inch connection for McHenry. Only the City of Crystal Lake and City of Woodstock appear to use this as the base ratio. McHenry's capacity ratio are listed below: Meter Capacity Size Ratio 3/4" 1.00 1" 2.80 1-1/2" 4.80 2" 8.00 3" 18 4" 50 6" 50 McHenry's existing Residential Sanitary Sewer Connection Fee is again the lowest of the group at 2,607 for the base unit of a Detached Single-Family home with two bedrooms. The Village of Lakewood comes in with the highest at $9,904 for an equivalent unit. The proposed sewer connection fees come out to be less than the existing McHenry fee. Non-Residential Sanitary Sewer Development Fees for McHenry rank lowest at the 3/4-inch base connection size compared against the City of Crystal Lake and City of Woodstock.However,with the City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 IA*TEI OODNAll same capacity ratios applied to McHenry, the fees start to surpass the neighboring communities between the 1-1/2"to 2"meter size. City of McHenry,Illinois 2019 Capital Development Fee Study• 190382.30 BAXTER WOODMAN APPENDICES BAXTER WOODMAN Appendix A CITY OF McHENRY POPULATION EQUIVALENT PROJECTIONS Number of Single Family Residential Multi-Family Commercial Residential Single Family Houses Density Number of Multi Multi-Family Density Commercial Density Near Future Development Development Type Total Acres Acres Houses per Acre (PE/Home) Family Units Units per Acre (PE/Home) Acres (PE/acre) Total P.E. Legend Lakes Single Family 165 107 0.6 3.5 375 Legend Lakes Part 2 Single Family 80 80 216 2.7 3.5 756 Preserves of Boone Creek Single Family 115 95 205 2.2 3.5 100 1.1 2.5 20 5 1068 Oaks at Irish Prairie Single Family 75 200 2.7 3.5 700 Bull Valley&Curran Commercial 20 20 5 100 West of Chapel Hill Road(south of 120) Single Family&Commercial 75 60 162 2.7 3.5 15 5 642 East of Chapel Hill Road(south of 120) Single Family&Commercial 110 88 238 2.7 3.5 22 5 942 TOTAL! 740 I 403 I 1344 I I I I I I 97 I I 4,582 Number of Single Family Residential Undevelopable Developable Single Family Houses Density Distant Future Development Development Type Total Acres Acres Acres Houses per Acre PE/Home)P.E. South of Bull Valley&Curran Single Family 230 50 180 486 2.7 3.5 1701 East of Crystal Lake Road Single Family 545 60 485 1310 2.7 3.5 4583 North McCullom Lake Road Single Family 335 335 905 2.7 3.5 3166 120&Martin Road Single Family 95 95 257 2.7 3.5 898 Chapel Hill Road(north of 120 Single Family&Commercial 100 80 216 2.7 3.5 20 5 193 TOTAL 1305 I 190 I 1311 I 2959 I 10,540 10/14/2019 kLLINOIS ENVIRONMENTAL PROTECTION AGENCY 1021 NORTH GRAND AVENUE EAST,P.O.Box 19276,SP1RINGFIELD,ILLINOIS 62794-9276 • (217)782-2829 BRUCE RAUNER,GOVERNOR LISA BONNETT, DIRECTOR 217/782-0610 October 14, 2015 1 City of McHenry 1 t 333 South Green Street McHenry, Illinois 60050 OM 2015 Re: McHenry -South WWTP NPDES Permit No. IL0066257 cr:.r,,r T.,:rn1-x;'(Y Final Permit h(; ;.,i,,•: C Gentlemen: Attached is the final NPDES Permit for your discharge. The Permit as issued covers discharge limitations, monitoring,and reporting requirements. Failure to meet any portion of the Permit could result in civil and/or criminal penalties. The Illinois Environmental Protection Agency is ready and willing to assist you in interpreting any of the conditions of the Permit as they relate specifically to your discharge. The Agency has completed our review of the comment letter dated September 8, 2015 and offers the following response: 1. The language in Special Condition 4 was revised based on comments from USEPA and remains unchanged. 2. Special Conditions 14 and 15 have been revised to include language requiring the optimization and feasibility studies be completed after the constructi6ff f the WWTP consolidation or 42 months after the effective date of this permit, whichever comes first. The Agency has begun a program allowing the submittal of electronic Discharge Monitoring Reports NetDMRs) instead of paper Discharge Monitoring Reports (DMRs). If you are interested in NetDMRs, more information can be found on the Agency website, http://epa.state.il.us/water/net-dmr/index.html. If your facility is not registered in the NetDMR program, a supply of preprinted paper DMR Forms for your facility will be sent to you prior to the initiation of DMR reporting under the reissued permit. Additional information and instructions will accompany the preprinted DMRs upon their arrival. The attached Permit is effective as of the date indicated on the first page of the Permit. Until the effective date of any re-issued Permit, the limitations and conditions of the previously-issued Permit remain in full effect. You have the right to appeal any condition of the Permit to the Illinois Pollution Control Board within a 35 day period following the issuance date. Should you have questions concerning the Permit, please contact Kaushal Desai at 217/782-0610. Sincerely, Alan Keller,P.E. Manager,Permit Section Division of Water Pollution Control SAK:KKD:15061601.bah Attachment: Final Permit 4302 N.Main St.,Rockford,IL 61 103(815)987-7760 951 I Harrison St.,Des Plaines,IL 60016(847)294-4000 595 S.State,Elgin.IL 60123(847)608-3131 412 5W Washington St.,Suite D,Peoria,IL 61 602(309)671-3022 2125 S.First St..Champaign,IL 61820(217)278-5800 2309 W.Main St.,Suite 116,Marlon,IL 62959(618)993.7200 2009 Mal(St.,Collinsville,IL 62234(618)346.5120 100 W.Randolph,Suite 10.300,Chicago,IL 60601 (312)81 4-6026 Page 2 cc: Records Compliance Assurance Section Des Plaines Region Billing HR Green US EPA Facility CMAP 4302 N.Main St.,Rockford,IL 61 103(815)987-7760 9511 Harrison St.,Des Plaines,IL 60016(847)294-4000595S.State,Elgin,IL 60123(847)608-3131 412 SW Washington St.,Suite D,Peoria,IL 61 602(309)671-30222125S.First St„Champaign,IL 61820(217)278-5800 2309 W.Main St.,Suite 1 16,Marion,IL 62959(618)993-72002009MallSt.,Collinsville,IL 62234'618)346-5120 100 W.Randolph,Suite 10-300,Chicago,IL 60601 (312181 4.6026 NPDES Permit No. IL0066257 Illinois Environmental Protection Agency Division of Water Pollution Control 1021 North Grand Avenue East Post Office Box 19276 Springfield, Illinois 62794-9276 NATIONAL POLLUTANT DISCHARGE ELIMINATION SYSTEM Reissued(NPDES)Permit Expiration Date: October 31, 2020 Issue Date: October 14, 2015 Effective Date: November 1, 2015 Name and Address of Permittee: Facility Name and Address: City of McHenry McHenry-South WWTP333SouthGreenStreet222SouthMcHenryAvenueMcHenry, Illinois 60050 McHenry, Illinois 60050 McHenry County) Receiving Waters: Fox River In compliance with the provisions of the Illinois Environmental Protection Act,Title 35 of the III.Adm. Code,Subtitle C,Chapter I,and the Clean Water Act (CWA), the above-named Permittee is hereby authorized to discharge at the above location to the above-named receiving stream in accordance with the Effluent Limitations, Monitoring,and Reporting requirements;Special Conditions and AttachmentHStandardConditionsattachedherein. Permittee is not authorized to discharge after the above expiration date. In order to receive authorization to discharge beyond the expiration date, the Permittee shall submit the proper application as required by the Illinois Environmental Protection Agency(IEPA)notlaterthan180dayspriortotheexpirationdate. d€141 Alan Keller, P.E. Manager, Permit Section Division of Water Pollution Control SAK:K K D:15061601.ba h rage 2 NPDES Permit No. IL0066257 Effluent Limitations, Monitoring,and Reporting. FINAL Discharge Number(s) and Name(s): 001 STP Outfall (Existing Facility) Load limits computed based on a design average flow(DAF)of 1.5 MGD(design maximum flow(DMF)of 4.2 MGD). From the effective date of this Permit until the start of operation of the proposed facility or expiration date, whichever comes first, theeffluentoftheabovedischarge(s) shall be monitored and limited at all times as follows: LOAD LIMITS lbs/day CONCENTRATION DAF (DMF)* LIMITS mq/L Monthly Weekly Daily Monthly Weekly Daily Sample SampleParameterAverageAverageMaximumAverageAverageMaximumFrequencyType Flow(MGD) Continuous CBOD5""' 167(500) 334(1001)20 40 3 Days/VVeek Composite Suspended Solids"'209(626) 375(1126)25 45 3 Days/Week Composite pH Shall be in the range of 6 to 9 Standard Units 3 Days/Week Grab Fecal Coliform Daily Maximum shall not exceed 400 per 100 mL 3 Days/Week Grab Chlorine Residual 0.05 3 Days/Week Grab Ammonia Nitrogen: As (N) March-May/Sept.-Oct. 19(53) 28 (77) 1.5 2.2 3 Days/VVeek Composite June-August 19 (53) 40 (112) 1.5 3.2 3 Days/VVeek Composite Nov.-Feb.34 (95) 2.7 3 Days/Week Composite Total Phosphorus(as P) 13 (35) 1.0 3 DaysNVeek Composite Total Nitrogen Monitor only 1 Day/Week Composite Monthly Weekly Average Average not less not less Daily than than MinimumDissolvedOxygen March-July N/A 6.0 5.0 3 Days/Week GrabAugust-February 5.5 4.0 3.5 3 Days/Week Grab Load limits based on design maximum flow shall apply only when flow exceeds design average flow. Carbonaceous BOD5(CBOD5)testing shall be in accordance with 40 CFR 136. BOD5 and Suspended Solids (85% removal required): In accordance with 40 CFR 133, the 30-day average percent removal shall notbelessthan85percentexceptasprovidedinSections133.103 and 133.105. The percent removal need not be reported to the IEPA onDMRsbutinfluentandeffluentdatamustbeavailable, as required elsewhere in this Permit, for IEPA inspection and review. Formeasuringcompliancewiththisrequirement, 5 mg/L shall be added to the effluent CBOD5 concentration to determine the effluent BOD5concentration. Percent removal is a percentage expression of the removal efficiency across a treatment plant for a given pollutant parameter, asdeterminedfromthe30-day average values of the raw wastewater influent concentrations to the facility and the 30-day average values oftheeffluentpollutantconcentrationsforagiventimeperiod. Flow shall be reported on the Discharge Monitoring Report(DMR) as monthly average and daily maximum.Fecal Coliform shall be reported on the DMR as a daily maximum value. pH shall be reported on the DMR as minimum and maximum value. Chlorine Residual shall be reported on DMR as daily maximum value. Dissolved oxygen shall be reported on the DMR as a minimum value. Total Phosphorus shall be reported on the DMR as a monthly average and daily maximum value. Page 3 NPDES Permit No. IL0066257 Effluent Limitations, Monitoring, and Reporting FINAL Discharge Number(s) and Name(s): 001 STP Outfall (Proposed Facility) Load limits computed based on a design average flow(DAF)of 4.0 MGD(design maximum flow(DMF)of 16.0 MGD). From the completion of construction and start of operation of the proposed facility until the expiration date, the effluent of the abovedischarge(s)shall be monitored and limited at all times as follows: LOAD LIMITS lbs/day CONCENTRATION DAF (DMF)*LIMITS mq/L Monthly Weekly Daily Monthly Weekly Daily Sample SampleParameterAverageAverageMaximumAverageAverageMaximumFrequencyTypeFlow(MGD) Continuous CBOD5**' 667(2669) 1334(5338)20 40 3 Days/VVeek Composite Suspended Solids**' 834(3336) 1501 (600).25 45 3 Days/Week Composite pH Shall be in the range of 6 to 9 Standard Units 3 Days/Week Grab Fecal Coliform Daily Maximum shall not exceed 400 per 100 mL 3 DaysWeek Grab Chlorine Residual 0.05 GrabAmmoniaNitrogen: As(N) March-May/Sept.-Oct. 50(200) 73 (294) 1.5 2.2 3 Days/Week CompositeJune-August 50(200) 107(427)1.5 3.2 3 Days/Week Composite Nov.-Feb. 90(360) 2.7 3 Days/Week Composite Total Phosphorus(as P) 33 (133) 1.0 3 Days/Week Composite Total Nitrogen Monitor only 1 Day/Week Composite Monthly Weekly Average Average not less not less Daily Dissolved Oxygen than than Minimum March-July N/A 6.0 5.0 3 Days/Week GrabAugust-February 5.5 4.0 3.5 3 Days/Week Grab Load limits based on design maximum flow shall apply only when flow exceeds design average flow. Carbonaceous BOD5(CBOD5)testing shall be in accordance with 40 CFR 136.See Special Condition 9. BOD5 and Suspended Solids(85% removal required): In accordance with 40 CFR 133, the 30-day average percent removal shall notbelessthan85percentexceptasprovidedinSections133.103 and 133.105. The percent removal need not be reported to the IEPA onDMRsbutinfluentandeffluentdatamustbeavailable, as required elsewhere in this Permit, for IEPA inspection and review. Formeasuringcompliancewiththisrequirement, 5 mg/L shall be added to the effluent CBOD5 concentration to determine the effluent BOD5concentration. Percent removal is a percentage expression of the removal efficiency across a treatment plant for a given pollutant parameter, asdeterminedfromthe30-day average values of the raw wastewater influent concentrations to the facility and the 30-day average values oftheeffluentpollutantconcentrationsforagiventimeperiod. Flow shall be reported on the Discharge Monitoring Report (DMR) as monthly average and daily maximum.Fecal Coliform shall be reported on the DMR as a daily maximum value. pH shall be reported on the DMR as minimum and maximum value. Chlorine Residual shall be reported on DMR as daily maximum value. Dissolved oxygen shall be reported on the DMR as a minimum value. Total Phosphorus shall be reported on the DMR as a monthly average and daily maximum value. Page 5 NPDES Permit No. IL0066257 Special Conditions SPECIAL CONDITION 1. This Permit may be modified to include different final effluent limitations or requirements which are consistentwithapplicablelawsandregulations. The IEPA will public notice the permit modification. SPECIAL CONDITION 2. The use or operation of this facility shall be by or under the supervision of a Certified Class 1 operator. SPECIAL CONDITION 3. The IEPA may request in writing submittal of operational information in a specified form and at a requiredfrequencyatanytimeduringtheeffectiveperiodofthisPermit. SPECIAL CONDITION 4. The IEPA may request more frequent monitoring by permit modification pursuant to 40 CFR § 122.63 andWithoutPublicNotice. SPECIAL CONDITION 5. The effluent, alone or in combination with other sources, shall not cause a violation of any applicable waterqualitystandardoutlinedin35III. Adm. Code 302. SPECIAL CONDITION 6. The Permittee shall record monitoring results on Discharge Monitoring Report (DMR) Forms using one suchformforeachoutfalleachmonth. In the event that an outfall does not discharge during a monthly reporting period, the DMR Form shall be submitted with no dischargeindicated. The Permittee may choose to submit electronic DMRs (NetDMRs) instead of mailing paper DMRs to the IEPA. More information,including registration information for the NetDMR program, can be obtained on the IEPA website,http://www.epa.state.il.us/water/net-dmr/index.html. The completed Discharge Monitoring Report forms shall be submitted to IEPA no later than the 25th day of the following month, unlessotherwisespecifiedbythepermittingauthority. Permittees not using NetDMRs shall mail Discharge Monitoring Reports with an original signature to the IEPA at the following address: Illinois Environmental Protection Agency Division of Water Pollution Control Attention: Compliance Assurance Section, Mail Code#19 1021 North Grand Avenue East Post Office Box 19276 Springfield, Illinois 62794-9276 SPECIAL CONDITION 7. The provisions of 40 CFR Section 122.41(m)&(n) are incorporated herein by reference. SPECIAL CONDITION 8. Samples taken in compliance with the effluent monitoring requirements shall be taken at a point representativeofthedischarge, but prior to entry into the receiving stream. SPECIAL CONDITION 9. For Discharge No. 001 (proposed facility), any use of chlorine to control slime growths, odors or as anoperationalcontrol, etc. shall not exceed the limit of 0.05 mg/L (daily maximum) total residual chlorine in the effluent. Sampling isrequiredonadailygrabbasisduringthechlorinationprocess. Reporting shall be submitted on the DMR's on a monthly basis. SPECIAL CONDITION 10. The Permittee shall conduct semi-annual monitoring of the effluent and report concentrations(in mg/I)of thefollowinglistedparameters. Monitoring shall begin three (3) months from the effective date of this permit. The sample shall be a24-hour effluent composite except as otherwise specifically provided below and the results shall be submitted on Discharge MonitoringReportFormstoIEPAunlessotherwisespecifiedbytheIEPA. The parameters to be sampled and the minimum reporting limits to beattainedareasfollows: STORET MinimumCODEPARAMETER reporting limit01002Arsenic 01007 Barium 0.05 mg/L 01027 Cadmium 0.5 mg/L mg/L01032Chromium (hexavalent) (grab) 0.0 01034 Chromium (total) 0.01 mg/L 0.05 mg/L01042Copper mg/L00718Cyanide(grab) (available***or amenable to chlorination) 5.0 u /L00720Cyanide(total) 5.0 ug/L 00951 y grab not to exceed 24 hours) 5.0 ug/LFluoride 0.1 mg/L page 6 NPDES Permit No. IL0066257 Special Conditions STORET Minimum CODE PARAMETER reporting limit 01045 Iron (total) 0.5 mg/L 01046 Iron(Dissolved) 0.5 mg/L 01051 Lead 0.05 mg/L 01055 Manganese 0.5 mg/L 71900 Mercury(grab)** 1.0 ng/L* 01067 Nickel 0.005 mg/L 00556 Oil (hexane soluble or equivalent) (Grab Sample only) 5.0 mg/L 32730 Phenols(grab) 0.005 mg/L 01147 Selenium 0.005 mg/L 01077 Silver(total) 0.003 mg/L 01092 Zinc 0.025 mg/L Minimum Reporting Limits are defined as—(1)The minimum value below which data are documented as non-detects. (2) Three to tentimesthemethoddetectionlimit. (3) The minimum value of the calibration range. All sample containers, preservative, holding times, analyses, method detection limit determinations and quality assurance/quality controlrequirementsshallbeinaccordancewith40CFR136. Unless otherwise indicated, concentrations refer to the total amount of the constituent present in all phases,whether solid,suspended or dissolved,elemental or combined, including all oxidation states. 1.0 ng/L= 1 part per trillion. Utilize USEPA Method 1631E and the digestion procedure described in Section 11.1.1.2 of 1631E. US EPA Method OIA-1677. The Permittee shall provide a report briefly describing the permittee's pretreatment activities and an updated listing of the Permittee'ssignificantindustrialusers. The list should specify which categorical pretreatment standards, if any, are applicable to each IndustrialUser. Permittees who operate multiple plants may provide a single report. Such report shall be submitted within six(6) months of the effective date of this Permit to the following addresses: U.S. Environmental Protection Agency Region 5 77 West Jackson Blvd. Chicago, Illinois 60604 Attention:Water Assurance Branch Enforcement and Compliance Illinois Environmental Protection Agency Division of Water Pollution Control Attention: Compliance assurance Section, Mail Code#19 1021 North Grand Avenue East Post Office Box 19276 Springfield, Illinois 62794-9276 SPECIAL CONDITION 11. During January of each year the Permittee shall submit annual fiscal data regarding sewerage systemoperationstotheIllinoisEnvironmentalProtectionAgency/Division of Water Pollution Control/Compliance Assurance Section. ThePermitteemayuseanyfiscalyearperiodprovidedtheperiodendswithintwelve(12) months of the submission date. Submission shall be on forms provided by IEPA titled"Fiscal Report Form For NPDES Permittees". SPECIAL CONDITION 12. The Permittee shall conduct biomonitoring of the effluent from Discharge Number(s)001. Biomonitorinq 1.Acute Toxicity - Standard definitive acute toxicity tests shall be run on at least two trophic levels of aquatic species (fish,invertebrate) representative of the aquatic community of the receiving stream. Testing must be consistent with Methods for Measuring the Acute Toxicity of Effluents and Receiving Waters to Freshwater and Marine Organisms (Fifth Ed.)EPA/821-R-02-012. Unless substitute tests are pre-approved;the following tests are required: a.Fish-96 hour static LC50 Bioassay using fathead minnows(Pimephales promelas). Page 7 NPDES Permit No. IL0066257 Special Conditions b.Invertebrate 48-hour static LC50 Bioassay using Ceriodaphnia. 2.Testing Frequency-The above tests shall be conducted using 24-hour composite samples unless otherwise authorized by theIEPA. Samples must be collected in the 18th, 15th, 12th, and 9th month prior to the expiration date of this Permit. 3.Reporting-Results shall be reported according to EPA/821-R-02-012, Section 12, Report Preparation,and shall be submitted to IEPA, Bureau of Water, Compliance Assurance Section within one week of receipt from the laboratory. Reports are due to the IEPA no later than the 16th, 13th, 10th, and 7th month prior to the expiration date of this Permit. 4.Toxicity- Should a bioassay result in toxicity to>20% of organisms test in the 100%effluent treatment, the IEPA may require, upon notification,six(6)additional rounds of monthly testing on the affected organism(s)to be initiated within 30 days of the toxic bioassay. Results shall be submitted to IEPA within (1) week of becoming available to the Permittee. Should any of theadditionalbioassaysresultintoxicityto >50% of organisms tested in the 100% effluent treatments, the Permittee shall immediately notify IEPA in writing of the test results. 5.Toxicity Reduction Evaluation and Identification- Should the biomonitoring program identify toxicity and result in notification byIEPA, the permittee shall develop a plan for toxicity reduction evaluation and identification. This plan shall be developed and implemented in accordance with Toxicity Reduction Evaluation Guidance for Municipal Wastewater Treatment Plants, EPA1833B-99/002, and shall include an evaluation to determine which chemicals have a potential for being discharged in the plant wastewater, a monitoring program to determine their presence or absence and to identify other compounds which are not being removed by treatment, and other measures as appropriate. The Permittee shall submit to the IEPA its plan within ninety90)days following notification by the IEPA. The Permittee shall implement the plan within ninety(90) days of notification date of the permittee above or other such date as is received by letter from IEPA. The IEPA may modify this Permit during its term to incorporate additional requirements or limitations based on the results of thebiomonitoring. In addition, after review of the monitoring results and toxicity reduction evaluation, the IEPA may modify this Permit to include numerical limitations for specific toxic pollutants and additional whole effluent toxicity monitoring to confirm theresultsoftheevaluation. Modifications under this condition shall follow public notice and opportunity for hearing. SPECIAL CONDITION 13. For the duration of this Permit, the Permittee shall determine the quantity of sludge produced by thetreatmentfacilityindrytonsorgallonswithaveragepercenttotalsolidsanalysis. The Permittee shall maintain adequate records of thequantitiesofsludgeproducedandhavesaidrecordsavailableforU.S. EPA and IEPA inspection. The Permittee shall submit to the IEPA, at a minimum, a semi-annual summary report of the quantities of sludge generated and disposed of, in units of dry tons or gallonsaveragetotalpercentsolids)by different disposal methods including but not limited to application on farmland,application on reclamationland, landfilling, public distribution, dedicated land disposal, sod farms, storage lagoons or any other specified disposal method. Said reports shall be submitted to the IEPA by January 31 and July 31 of each year reporting the preceding January thru June and July thruDecemberintervalofsludgedisposaloperations. Duty to Mitigate. The Permittee shall take all reasonable steps to minimize any sludge use or disposal in violation of this Permit. Sludge monitoring must be conducted according to test procedures approved under 40 CFR 136 unless otherwise specified in 40 CFR503, unless other test procedures have been specified in this Permit. Planned Changes. The Permittee shall give notice to the IEPA on the semi-annual report of any changes in sludge use and disposal. The Permittee shall retain records of all sludge monitoring, and reports required by the Sludge Permit as referenced in Standard Condition25foraperiodofatleastfive(5)years from the date of this Permit. If the Permittee monitors any pollutant more frequently than required by this permit or the Sludge Permit,the results of this monitoring shallbeincludedinthereportingofdatasubmittedtotheIEPA. The Permittee shall comply with existing federal regulations governing sewage sludge use or disposal and shall comply with all existingapplicableregulationsinanyjurisdictioninwhichthesewagesludgeisactuallyusedordisposed. The Permittee shall comply with standards for sewage sludge use or disposal established under section 405(d)of the CWA within the timeprovidedintheregulationsthatestablishthestandardsforsewagesludgeuseordisposalevenifthepermithasnotbeenmodifiedtoincorporatetherequirement. The Permittee shall ensure that the applicable requirements in 40 CFR Part 503 are met when the sewage sludge is applied to the land,placed on a surface disposal site, or fired in a sewage sludge incinerator. Page 8 NPDES Permit No. IL0066257 Special Conditions Monitoring reports for sludge shall be reported on the form titled "Sludge Management Reports"to the following address: Illinois Environmental Protection Agency Bureau of Water Compliance Assurance Section Mail Code#19 1021 North Grand Avenue East Post Office Box 19276 Springfield, Illinois 62794-9276 SPECIAL CONDITION 14. The Permittee shall develop and submit to the Agency a Phosphorus Discharge Optimization Plan withineighteen (18) months from completion of construction of the WWTP consolidation or 42 months after the effective date of this permit,whichever comes first. The plan shall include a schedule for the implementation of these optimization measures. Annual progressreportsontheoptimizationoftheexistingtreatmentfacilitiesshallbesubmittedtotheAgencybyMarch31ofeachyear. In developingtheplan, the Permittee shall evaluate a range of measures for reducing phosphorus discharges from the treatment plant,includingpossiblesourcereductionmeasures, operational improvements, and minor facility modifications that will optimize reductions inphosphorusdischargesfromthewastewatertreatmentfacility. The Perrittee's evaluation shall include, but not be limited to, anevaluationofthefollowingoptimizationmeasures: A. WWTF influent reduction measures. 1. Evaluate the phosphorus reduction potential of users. 2. Determine which sources have the greatest opportunity for reducing phosphorus(i.e., industrial, commercial, institutional,municipal and others). a. Determine whether known sources(i.e.,restaurant and food preparation) can adopt phosphorus minimization andwaterconservationplans. b. Evaluate implementation of local limits on influent sources of excessive phosphorus. B. WWTF effluent reduction measures without causing non-compliance with permit effluent limitations or adversely impactingstreamhealth. 1. Reduce phosphorus discharges by optimizing existing treatment processes without causing non-compliance with permiteffluentlimitationsoradverselyimpactingstreamhealth. a. Adjust the solids retention time for biological phosphorus removal. b. Adjust aeration rates to reduce dissolved oxygen and promote biological phosphorus removal.c. Change aeration settings in plug flow basins by turning off air or mixers at the inlet side of the basin system.d. Minimize impact on recycle streams by improving aeration within holding tanks.e. Adjust flow through existing basins to enhance biological nutrient removal.f. Increase volatile fatty acids for biological phosphorus removal. SPECIAL CONDITION 15. The Permittee shall,within eighteen (18)months from completion of construction of the WWTP consolidationor42monthsaftertheeffectivedateofthispermit,whichever comes first, prepare and submit to the Agency a feasibility study thatidentifiesthemethod,timeframe,and costs of reducing phosphorus levels in its discharge to a level consistently meeting a potential futureeffluentlimitof0.5 mg/L and 0.1 mg/L on a monthly, seasonal and annual average basis. The study shall evaluate the construction andO&M costs of the application of these limits on an annual average basis. SPECIAL CONDITION 16:This Permit may be modified to include alternative or additional final effluent limitations pursuant to anapprovedTotalMaximumDailyLoad(TMDL) Study or upon completion of an alternate water quality study. SPECIAL CONDITION 17. The Permittee shall work towards the goals of achieving no discharges from sanitary sewer overflows orbasementback-ups and ensuring that overflows or back-ups, when they do occur do not cause or contribute to violations of applicablestandardsorcauseimpairmentinanyadjacentreceivingwater. Overflows from sanitary sewers are expressly prohibited by this PermitandbyIII.Adm. Code 306.304. In order to accomplish these goals of complying with this prohibition and mitigating the adverse impacts ofanysuchoverflowsiftheydooccur,the Permittee shall(A)identify and report to IEPA all SSOs that do occur,and(B)develop,implementandsubmittotheIEPAaCapacity, Management, Operations, and Maintenance (CMOM) plan which includes an Asset Managementstrategywithintwelve(12) months of the effective date of this Permit or review and revise any existing plan accordingly. The permitteeshallmodifythePlantoincorporateanycommentsthatitreceivesfromIEPAandshallimplementthemodifiedplanassoonaspossible.The Permittee should work as appropriate, in consultation with affected authorities at the local, county, and/or state level to develop theplancomponentsinvolvingthirdpartynotificationofoverflowevents. The Permittee may be required to construct additional sewagetransportand/or treatment facilities in future permits or other enforceable documents should the implemented CMOM plan indicate thatthePermittee's facilities are not capable of conveying and treating the flow for which they were designed. The CMOM plan shall include the following elements: Page 9 NPDES Permit No. IL0066257 Special Conditions A. Measures and Activities: 1. A complete map and system inventory for the collection system owned and operated by the Permittee;2. Organizational structure; budgeting;training of personnel; legal authorities; schedules for maintenance, sewer system cleaning,and preventative rehabilitation;checklists,and mechanisms to ensure that preventative maintenance is performed on equipmentownedandoperatedbythePermittee; 3. Documentation of unplanned maintenance; 4. An assessment of the capacity of the collection and treatment system owned and operated by the Permittee at critical junctionsandimmediatelyupstreamoflocationswhereoverflowsandback-ups occur or are likely to occur; use flow monitoring asnecessary; 5. Identification and prioritization of structural deficiencies in the system owned and operated by the Permittee;6. Operational control, including documented system control procedures, scheduled inspections and testing;7. The Permittee shall develop and implement an Asset Management strategy to ensure the long-term sustainability of thecollectionsystem. Asset management shall be used to assist the Permittee in making decisions on when it is most appropriatetorepair, replace or rehabilitate particular assets and develop long-term funding strategies; and8. Asset management shall include but is not limited to the following elements: a. Asset Inventory and State of the Asset; b. Level of Service; c. Critical Asset Identification; d. Life Cycle Cost; and e. Long-Term Funding Strategy. B. Design and Performance Provisions: 1. Monitor the effectiveness of CMOM; 2. Upgrade the elements of the CMOM plan as necessary; and3. Maintain a summary of CMOM activities. C. Overflow Response Plan: 1. Know where overflows and back-ups within the facilities owned and operated by the Permittee occur;2. Respond to each overflow or back-up to determine additional actions such as clean up; and3. Locations where basement back-ups and/or sanitary sewer overflows occur shall be evaluated as soon as practicable forexcessiveinflow/infiltration, obstructions or other causes of overflows or back-ups as set forth in the System Evaluation Plan. D. System Evaluation Plan: 1. Summary of existing SSO and Excessive I/I areas in the system and sources of contribution;2. Evaluate plans to reduce I/I and eliminate SSOs; 3. Special provisions for Pump Stations and force mains and other unique system components; and4. Construction plans and schedules for correction. E. Reporting and Monitoring Requirements: 1. Program for SSO detection and reporting; and 2. Program for tracking and reporting basement back-ups, including general public complaints. F. Third Party Notice Plan: 1. Describes how, under various overflow scenarios, the public, as well as other entities, would be notified of overflows within thePermittee's system that may endanger public health, safety or welfare;2. Identifies overflows within the Permittee's system that would be reported, giving consideration to various types of eventsincludingeventswithpotentialwidespreadimpacts; 3. Identifies who shall receive the notification; 4. Identifies the specific information that would be reported including actions that will be taken to respond to the overflow;5. Includes a description of the lines of communication;and 6. Includes the identities and contact information of responsible POTW officials and local, county, and/or state level officials. For additional information concerning USEPA CMOM guidance and Asset Management please refer to the following web site addresses.http://www.epa.gov/nodes/pubs/cmom guide for collection systems.pdf andhttp://water.epa.gov/type/watersheds/wastewater/upload/guide smallsystems assetmanagement bestpractices.pdf Page 10 Attachment H 8-Hour Composite Sample means a combination of at least 3 sample aliquots of at least 100 milliliters, collected at periodicStandardConditionsintervalsduringtheoperatinghoursofafacilityoveran8-hour Definitions period. Act means the Illinois Environmental Protection Act, 415 ILCS 5 as Flow Proportional Composite Sample means a combination of Amended. sample aliquots of at least 100 milliliters collected at periodic intervals such that either the time interval between each aliquot or Agency means the Illinois Environmental Protection Agency. the volume of each aliquot is proportional to either the stream flow at the time of sampling or the total stream flow since the collection Board means the Illinois Pollution Control Board. of the previous aliquot. Clean Water Act (formerly referred to as the Federal Water ( 1) Duty to comply. The permittee must comply with all Pollution Control Act) means Pub. L 92-500, as amended. 33 constitute of this permit. Any permitngnoncompliancensrU.S.C. 1251 et seq. constitutes a violation of the Act and is grounds for enforcement action, permit termination, revocation and NPDES (National Pollutant Discharge Elimination System) means reissuance, modification, or for denial of a permit renewal the national program for issuing, modifying, revokingand e application. The permittee shall comply with effluent standardspgg' g, or prohibitions established under Section 307(a) of the Cleanterminating, monitoring and enforcing permits, and imposing and Water Act for toxic pollutants within the time provided in theenforcingpretreatmentrequirements, under Sections 307, 402, 318 regulations that establish these standards or prohibitions, evenand405oftheCleanWaterAct. if the permit has not yet been modified to incorporate the USEPA means the United States Environmental Protection Agency. requirements. Daily Discharge means the discharge of a 2) Duty to reapply. If the permittee wishes to continue an activitygpollutantmeasured regulated by this permit after the expiration date of this permit,during a calendar day or any 24-hour period that reasonably the permittee must apply for and obtain a new permit. If therepresentsthecalendardayforpurposesofsampling. For permittee submits apollutantswithlimitationsexpressedinunitsofmass, the "daily proper applicationtheh as required by the discharge" is calculated as the total mass of the pollutant permAgency h later than in80 days prior and expiration the this discharged over the day. For pollutants with limitations expressed Agency shall i continue the in pfull tione effect until the final in other units of measurements, the "daily discharge" is calculated decision on application has been made. as the average measurement of the pollutant over the day. 3) Need to halt or reduce activity not a defense. It shall not be a defense for a permittee in an enforcement action that it wouldMaximumDailyDischargeLimitation(daily maximum)means the highest allowable daily discharge. have been necessary to halt or reduce the permitted activity in order to maintain compliance with the conditions of this permit. Average Monthly Discharge Limitation (30 day average) means the highest allowable average of daily discharges over a calendar ( 4) steps to mitigate.e. The permitteey shall take all violation ofahismonth, calculated as the sum of all daily discharges measured steps to minimize or prevent any discharge in this during a calendar month divided by the number of daily discharges permit which has a reasonablelikelihood of adversely affecting measured during that month. human healthh or the envi ronment. Average Weekly Discharge Limitation(7 day average)means the ( 5) Proper operation and maintenance. The permittee shall at all times properly operate and maintain all facilities andhighestallowableaverageofdailydischargesoveracalendar week, calculated as the sum of all daily discharges measured systemsaref treatment and controld (and related appurtenances) during a calendar week divided by the number of daily discharges which installedithc or used by the pt. Propere to operationnmeasuredduringthatweek,compliance with conditions of this permit. and maintenance includes effective performance, adequate funding, adequate operator staffing and training, and adequateBestManagementPractices (BMPs) means schedules of activities, prohibitions of practices, maintenance procedures, and laboratory and processr hist provision, requ apphe p quality other management practices to prevent or reduce the pollution of back-up, r auxdury cats , srequires the operationoly n waters of the State. BMPs also include treatment requirements, back-up, or auxiliary facilities, c withertheystems only of theoperatingprocedures, and practices to control plant site runoff, necessary to achieve compliance conditions the spillage or leaks, sludge or waste disposal, or drainage from raw permit. material storage. 6) Permit actions. This permit may be modified, revoked and reissued,or terminated for cause by the Agency pursuant to 40Aliquotmeansasampleofspecifiedvolumeusedtomakeupatotalcompositesample. CFR 122.62 and 40 CFR 122.63. The filing of a request by the permittee for a permit modification, revocation and reissuance, Grab Sample means an individual sample of at least 100 milliliters or termination, or a notification of planned changes or collected at a randomly-selected time over a period not exceeding anticipated noncompliance,does not stay any permit condition. 15 minutes. 7) Property rights. This permit does not convey any property 24-Hour Composite Sample means a combination of at least 8 rights of any sort,or any exclusive privilege. sample aliquots of at least 100 milliliters, collected at periodic (8) Duty to provide information. The permittee shall furnish tointervalsduringtheoperatinghoursofafacilityovera24-hour period. the Agency within a reasonable time,any information which the Agency may request to determine whether cause exists for modifying, revoking and reissuing, or terminating this permit, or to determine compliance with the permit. The permittee shall also furnish to the Agency upon request, copies of records reauired to he keot by this permit. Page 11 9) Inspection and entry. The permittee shall allow an authorized authorized representative only if:representative of the Agency or USEPA (including an 1) The authorization is made in writing by a personauthorizedcontractoractingasarepresentativeoftheAgencydescribedinparagraph(a);and or USEPA), upon the presentation of credentials and other 2) The authorization specifies either an individual or adocumentsasmayberequiredbylaw, to: position responsible for the overall operation of thea) Enter upon the permittee's premises where a regulated facility, from which the discharge originates, such asfacilityoractivityislocatedorconducted,or where records a plant manager, superintendent or person ofmustbekeptundertheconditionsofthispermit; equivalent responsibility; andb) Have access to and copy,at reasonable times,any 3) The written authorization is submitted to the Agency.records that must be kept under the conditions of this c) Changes of Authorization. If an authorization under(b)permit; is no longer accurate because a different individual orc) Inspect at reasonable times any facilities, equipment position has responsibility for the overall operation of theincludingmonitoringandcontrolequipment), practices, or facility, a new authorization satisfying the requirements ofoperationsregulatedorrequiredunderthispermit; and b) must be submitted to the Agency prior to or togetherd) Sample or monitor at reasonable times, for the purpose of with any reports, information, or applications to be signedassuringpermitcompliance,or as otherwise authorized by by an authorized representative.the Act,any substances or parameters at any location. d) Certification. Any person signing a document under paragraph (a) or (b) of this section shall make the10) Monitoring and records. following certification:a) Samples and measurements taken for the purpose of monitoring shall be representative of the monitored I certify under penalty of law that this document and allactivity. attachments were prepared under my direction orb) The permittee shall retain records of all monitoring supervision in accordance with a system designed toinformation, including all calibration and maintenance assure that qualified personnel properly gather andrecords, and all original strip chart recordings for evaluate the information submitted. Based on my inquirycontinuousmonitoringinstrumentation, copies of all of the person or persons who manage the system, orreportsrequiredbythispermit, and records of all data those persons directly responsible for gathering theusedtocompletetheapplicationforthispermit, for a information, the information submitted is, to the best ofperiodofatleast3yearsfromthedateofthispermit, my knowledge and belief, true, accurate, and complete. Imeasurement, report or application. Records related to am aware that there are significant penalties forthepermittee's sewage sludge use and disposal activities submitting false information, including the possibility ofshallberetainedforaperiodofatleastfiveyears (or fine and imprisonment for knowing violations.longer as required by 40 CFR Part 503), This period maybeextendedbyrequestoftheAgencyorUSEPAatany (12) Reporting requirements.time. a) Planned changes. The permittee shall give notice to thec) Records of monitoring information shall include: Agency as soon as possible of any planned physical1) The date, exact place, and time of sampling or alterations or additions to the permitted facility.measurements; Notice is required when:2) The individual(s) who performed the sampling or 1) The alteration or addition to a permitted facility maymeasurements; meet one of the criteria for determining whether a3) The date(s)analyses were performed; facility is a new source pursuant to 40 CFR 122.294) The individual(s)who performed the analyses;b);or5) The analytical techniques or methods used;and 2) The alteration or addition could significantly change6) The results of such analyses. the nature or increase the quantity of pollutantsd) Monitoring must be conducted according to test discharged. This notification applies to pollutantsproceduresapprovedunder40CFRPart136, unless other which are subject neither to effluent limitations in thetestprocedureshavebeenspecifiedinthispermit. Where permit, nor to notification requirements pursuant tonotestprocedureunder40CFRPart136hasbeen40CFR122.42(a)(1).approved, the permittee must submit to the Agency a test 3) The alteration or addition results in a significantmethodforapproval. The permittee shall calibrate and change in the permittee's sludge use or disposalperformmaintenanceproceduresonallmonitoringandpractices, and such alteration, addition, or changeanalyticalinstrumentationatintervalstoensureaccuracyofmeasurements. may justify the application of permit conditions that are different from or absent in the existing permit, 11) Signatory requirement. All applications, reports or including notification of additional use or disposal information submitted to the Agency shall he signed and pr cs not reported duringdsthe permit application certified. process or not reported pursuant to an approved a) Application. All permit applications shall be signed as b land application plan. follows: Anticipated noncompliance. The permittee shall givefollows: For a corporation: by a principal executive officer of advance notice to the Agency of any planned changes in the permitted facility or activity which may result inatleastthelevelofvicepresidentorapersonornoncompliancewithpermitrequirements.position having overall responsibility for c) Transfers. This permit is not transferable to any personenvironmentalmattersforthecorporation: 2) For a partnership or sole proprietorship: byageneral except after notice to the Agency.d) Compliance schedules. Reports of compliance orpartnerortheproprietor, respectively;or noncompliance with, or any(3) For a municipality, State, Federal, or otherpublic progress reports on, interim and final requirements contained in any complianceagency: by either a principal executive officer or schedule of this permit shall be submitted no later than 14rankingelectedofficial. days following each schedule date.b) Reports. All reports required by permits, or other bya e) Monitoring reports. Monitoring results shall bo reportedinformationrequestedbytheAgencyshallbesignedattheintervalsspecifiedelsewhereinthispermit.person described in paragraph(a)or by a duly authorized 1) Monitoring results must be reported on a Dischargerepresentativeofthatnarsnnanarennis .-, ,,,,,,, g Page•12 2) If the permittee monitors any pollutant more required in paragraph(12)(f)(24-hour notice).frequently than required by the permit, using test d) Prohibition of bypass.procedures approved under 40 CFR 136 or as specified in the permit, the results of this monitoring 1) Bypass is prohibited, and theAgency may take enforcement action against a permittee Forshallbeincludedinthecalculationandreportingofbypass,unless:the data submitted in the DMR. i) Bypass was unavoidable to prevent loss of life,3) Calculations for all limitations which require personal injury,or severe property damage;averaging of measurements shall utilize an arithmetic enc ii) There were no feasible alternatives to themeanunlessotherwisespecifiedbytheAin the permit. g Y bypass, such as the use of auxiliary treatment f) Twenty-four hour reporting. The permittee shall report facilities, retention of untreated wastes, or any noncompliance which may endanger health or the maintenance during This condition periods of environment. Any information shall be provided orallysauipment dequate . Tuffs uipn is not satisfied if adequate hack-up equipment shouldwithin24-hours from the time the permittee becomes aware of the circumstances. A written submission shall reashave been installed inthe to exercise of also be provided within 5 days of the time the permittee bypass ble engineering occurred judgment normal prevent a becomes aware of the circumstances. The written ofequipment which ow imeduring periodsnesubmissionshallcontainadescriptionofthemaintenance; downtime or preventive noncompliance and its cause; the period of and noncompliance, including exact dates and time; and if the iii) uTnderr permitteearrasubmi( 13)(tted notices as required noncompliance has not been corrected, the anticipated 2)Agencygn may etimeitisexpectedtocontinue; and steps taken or The idmay r an anticipated bypass, planned to reduce, eliminate, and prevent reoccurrence aftere micones thatg its adverse the three if the Agency of the noncompliance. The following shall be included as determines n it grl meet the conditions information which must be reported within 24-hours: listed above in paragraph(13)(d)(1). 1) Any unanticipated bypass which exceeds any (14) Upset. effluent limitation in the permit. a)Definition. Upset means an exceptional incident in which2) Any upset which exceeds any effluent limitation in there is unintentional and temporary noncompliance withthepermit. technology based permit effluent limitations because of3) Violation of a maximum daily discharge limitation for factors beyond the reasonable control of the permittee.any of the pollutants listed by the Agency in the An upset does not include noncompliance to the extentpermitoranypollutantwhichmayendangerhealthorcausedbyoperationalerror, improperly designedtheenvironment. treatment facilities, inadequate treatment facilities, lack ofTheAgencymaywaivethewrittenreportonacase- preventive maintenance, or careless or improperby-case basis if the oral report has been received operation.within 24-hours. b)Effect of an upset. An upset constitutes an affirmativeg) Other noncompliance. The permittee shall report all defense to an action brought for noncompliance with suchinstancesofnoncompliancenotreportedundertechnologybasedpermiteffluentlimitationsiftheparagraphs (12) (d), (e), or (f), at the time monitoring requirements of paragraph (14)(c) are met. Noreportsaresubmitted. The reports shall contain the determination made during administrative review ofinformationlistedinparagraph(12)(f). claims that noncompliance was caused by upset, andh) Other information. Where the permittee becomes before an action for noncompliance, is final administrativeawarethatitfailedtosubmitanyrelevantfactsinapermitactionsubjecttojudicialreview.application, or submitted incorrect information in a permit c)Conditions necessary for a demonstration of upset. Aapplication, or in any report to the Agency, it shall permittee who wishes to establish the affirmative defensepromptlysubmitsuchfactsorinformation. of upset shall demonstrate, through properly signed,13) Bypass. contemporaneous operating logs, or other relevanta) Definitions. evidence that: 1) Bypass means the intentional diversion of waste 1)An upset occurred and that the permittee can identifystreamsfromanyportionofatreatmentfacility, the cause(s)of the upset; 2) Severe property damage means substantial 2) operated;Tpe permitted facility was at the time being properlyphysicaldamagetoproperty, damage to the andphysictreatmentalfacilitiesmawhichcausesthem o become 3)The permittee submitted notice of the upset as a or substantial and p them toot loss f required in paragraph(12)(f)(2)(24-hour notice). natural resources which can reasonably be 4)There undertee compliedrag with any remedial measures expected to occur in the absence of a bypass. required paragraph(4).yp d)Burden of proof. In any enforcement proceeding theSeverepropertydamagedoesnotmeaneconomic permittee seeking to establish the occurrence of an upsetlosscausedbydelaysinproduction.b) Bypass not exceeding limitations. The permittee may has the burden of proof. allow any bypass to occur which does not cause (15) Transfer of permits. Permits may be transferred byeffluentlimitationstobeexceeded, but only if it also is modification or automatic transfer as described below:for essential maintenance to assure efficient a)Transfers by modification. Except as provided inoperation. These bypasses are not subject to the paragraph (b), a permit may be transferred by theprovisionsofparagraphs(13)(c)and(13)(d). c) Notice. permittee to a new owner or operator only if the permithasbeenmodifiedorrevokedandreissuedpursuantto1) Anticipated bypass. If the permittee knows in 40 CFR 122.62 (b) (2), or a minor modification madeadvanceoftheneedforabypass, it shall submit pursuant to 40 CFR 122.63 (d), to identify the newpriornotice, if possible at least ten days before permittee and incorporate such other requirements asthedateofthebypass. may be necessary under the Clean Water Act.2) Unanticipated bypass, The permittee shall submit notice of an unanticipated bvoass as Page 13 b)Automatic transfers. As an alternative to transfers under (19) If an applicable standard or limitation is promulgated underparagraph (a), any NPDES permit may be automatically Section 301(b)(2)(C) and (D), 304(b)(2), or 307(a)(2)and thattransferredtoanewpermitteeif: effluent standard or limitation is more stringent than any1)The current permittee notifies the Agency at least 30 effluent limitation in the permit, or controls a pollutant notdaysinadvanceoftheproposedtransferdate; limited in the permit, the permit shall be promptly modified or2)The notice includes a written agreement between the revoked, and reissued to conform to that effluent standard orexistingandnewpermitteescontainingaspecifiedlimitation.date for transfer of permit responsibility, coverage andliabilitybetweentheexistingandnewpermittees;and 20) Any authorization to construct issued to the permittee3)The Agency does not notify the existing permittee and pursuant to 35 III. Adm. Code 309.154 is hereby incorporatedtheproposednewpermitteeofitsintenttomodifyorbyreferenceasaconditionofthispermit.revoke and reissue the permit. If this notice is notreceived, the transfer is effective on the date specified (21) The permittee shall not make any false statement, in the agreement. representation or certification in any application, record,16) All manufacturing, commercial, mining, and silvicultural report, plan or other document submitted to the Agency or thedischargersmustnotifytheAgencyassoonastheyknoworUSEPA, or required to be maintained under this permit.have reason to believe: a) That any activity has occurred or will occur which would ( 22) The Clean Water Act provides that any person who violates aresultinthedischargeofanytoxicpollutantidentifiedpermitconditionimplementingSections301, 302, 306, 307,under in of the Clean Water not 308, 318, or 405 of the Clean Water Act is subject to a civillimitedSectionintheperm of ifh Cl dischargeoWatr Actl whichceis the penalty not to exceed $25,000 per day of such violation. Anypersonwhowillfullyornegligentlyviolatespermitconditionshighestofthefollowingnotificationlevels: 1) One hundred micrograms per liter(100 ug/I); implementing Sections 301, 302, 306, 307, 308, 318 or 405 of2) 1 Two hundred microgramsthe Clean Water Act is subject to a fine of not less thanacroleinwandramicrograe; fiveperh liter 200 ug/l) microgr for 2,500 nor more than $25,000 per day of violation, or bypperliter (500 ugh!) for 2,4-dinitrophenol and for 2- imprisonment for not more than one year, or both.e liter 0 ugh) or and one milligram per liter Additional penalties for violating these sections of the Clean1mg/I)for antimony.Water Act are identified in 40 CFR 122.41 (a)(2)and(3).3) Five (5) times the maximum concentration value ( 23) The Clean Water Act provides that any person who falsifies,reported for that pollutant in the NPDES application;or permit tampers with, or knowingly renders inaccurate any monitoring4) The level established by the in this permit, device or method required to be maintained under this permitb) That they have or expect Agency to use or shall, upon conviction, be punished by a fine of not more thanmanufactureasebegun intermediateexpec or beginegi product or 10,000, or by imprisonment for not more than 2 years, orboth. If a conviction of a person is for a violation committedbyproductanytoxicpollutantwhichwasnotreportedin after a first conviction of such person under this paragraph,the NPDES permit application. 17) All Publicly Owned Treatment Works (POTWs) must provide punishment is a fine of not more than $20,000 per day ofviolation, or by imprisonment of not more than 4 years, oradequatenoticetotheAgencyofthefollowing: both. a) Any new introduction of pollutants into that POTW from ly an indirectnew dischargewhich fp would subjectthtto W froms (24) The Clean Water Act provides that any301nor306ofeCleanWateroulbetifitweredirectlycnmakesanyfalsestatement, representation, person certification inanyrecordorotherdocumentsubmittedorrequiredtobedischargingthosepollutants;and b) Any substantial change in the volume or character of maintained under this permit, including monitoring reports orpollutantsbeingintroducedintothatPOTWbyasource reports of compliance or non-compliance shall, uponnsgutantsintothehatP at the time of conviction, be punished by a fine of not more than $10,000introduissuanceofthepermit. per violation, or by imprisonment for not more than 6 monthsc) For purposes of this paragraph, adequate notice shall per violation,or by both. include information on (i) the quality and quantity ofinclude introduced to the POW!, and (ii) any ( 25) Collected screening, slurries, sludges, and other solids shalleffluent impact of the change on the quantity or)qualityn be disposed of in such a manner as to prevent entry of thoseanticiofeffluenttobedischargedfromthePOTW. wastes (or runoff from the wastes) into waters of the State. 18) If the permit is issued to a publicly owned or publicly regulated The proper authorization for such disposal shall be obtained treatment works, the permittee shall require any industrial from the Agency and is incorporated as part hereof byreference. user of such treatment works to comply with federalrequirementsconcerning: 26) In case of conflict between these standard conditions and anya) User charges pursuant to Section 204 (h) of the Clean other condition(s) included in this permit, the otherWaterAct, and applicable regulations appearing in 40 condition(s)shall govern.CFR 35: b) Toxic pollutant effluent standards and pretreatment ( 27) The permittee shall comply with, in addition to the requirements of the permit, all applicable provisions of 35 III.standards pursuant to Section 307 of the Clean WaterAct;and Adm. Code, Subtitle C, Subtitle D, Subtitle E, and allc) Inspection, monitoring and entry pursuant to Section 308 applicable orders of the Board or any court with jurisdiction.of the Clean Water Act. 28) The provisions of this permit are severable, and if anyprovisionofthispermit, or the application of any provision ofthispermitisheldinvalid, the remaining provisions of thisRev. 7-9-2010 bah) permit shall continue in full force and effect. Appendix C WATER CONNECTION FEE RESIDENTIAL EXISTING PROPOSED WATER CONNECTION NEIGHBORING COMMUNITIES McHENRY FEE McHENRY Type of Unit Option 1 Option 2 Option 3 Algonquin Cary Crystal Lake Lakewood LITH Woodstock Detached Single-Family 2 Bedroom 2,199 $ 1,899 $ 2,870 $819 $ 7,571 $ 5,864 $ 4,456 $ 10,766 $ 9,740 $ 2,368 3 Bedroom 3,811 $ 2,729 $ 4,125 $ 1,177 $ 8,040 $ 5,864 $ 4,456 $ 10,766 $ 11,800 $ 3,395 4 Bedroom 4,098 $ 3,543 $ 5,356 $ 1,528 $ 8,040 $ 5,864 $ 4,456 $ 10,766 $ 11,800 $ 3,395 5 Bedroom 4,098 $ 3,549 $ 5,364 $ 1,530 $ 8,040 $ 5,864 $ 4,456 $ 10,766 $ 11,800 $ 3,395 Attached Single-Family 1 Bedroom 1,300 $ 1,123 $1,698 $484 $ 7,571 $ 4,340 10,766 $ 6,500 $ 1,401 2 Bedroom 2,164 $ 1,873 $ 2,832 $808 $ 7,571 $ 4,340 10,766 $ 9,740 $ 2,329 3 Bedroom 2,602 $ 2,252 $ 3,404 $971 $ 8,040 $ 4,340 10,766 $ 11,800 $ 2,801 4 Bedroom 3,426 $ 2,960 $ 4,475 $ 1,276 $ 8,040 $ 4,340 10,766 $ 11,800 $ 2,801 Apartments Efficiency 1,408 $ 1,218 $ 1,842 $ 525 2,062 1 Bedroom 1,912 $ 1,655 $ 2,502 $ 714 2,062 2 Bedroom 2,084 $ 1,802 $ 2,724 $777 2,251 3 Bedroom 3,325 $ 2,874 $ 4,344 $ 1,239 3,585 NON-RESIDENTIAL EXISTING PROPOSED WATER CONNECTION NEIGHBORING COMMUNITIES McHENRY FEE McHENRY Meter Size Option 1 Option 2 Option 3 Algonquin Cary Crystal Lake Lakewood LITH Woodstock 3/4" 3,811 $2,590 $ 3,920 $1,120 3,428 3,086 1" 10,655 $7,252 $10,976 $3,136 4,456 $ 10,766 $ 11,800 $ 3,086 1-1/2" 18,288 $ 12,432 $18,816 $5,376 6,536 $ 6,856 $ 21,532 $ 16,650 $ 6,172 2" 30,478 $ 20,720 $31,360 $8,960 9,332 $ 10,284 $ 43,070 $ 34,380 $ 10,029 3" 68,578 $ 46,620 $70,560 $ 20,160 13,712 $ 96,910 4" 190,492 $ 129,500 $ 196,000 $ 56,000 17,140 $ 215,357 6" 190,492 $ 129,500 $ 196,000 $ 56,000 20,568 $ 430,717 8" 466,200 $ 705,600 $ 201,600 4/13/2020 Appendix D SANITARY SEWER CONNECTION FEE RESIDENTIAL EXISTING PROPOSED SEWER McHENRY CONNECTION FEE NEIGHBORING COMMUNITIES McHENRY Type of Unit Option 1 Option 2 Algonquin Cary Crystal Lake Lakewood Woodstock Detached Single-Family 2 Bedroom 2,607 $ 1,410 $ 1,053 $ 6,861 $ 6,656 $6,153 $ 9,904 $ 3,635 3 Bedroom 3,739 $ 2,027 $ 1,514 $ 7,658 $ 6,656 $6,153 $ 9,904 $ 5,225 4 Bedroom 4,788 $ 2,631 $ 1,966 $ 7,658 $ 6,656 $6,153 $ 9,904 $ 5,225 5 Bedroom 4,868 $ 2,635 $ 1,969 $ 7,658 $ 6,656 $6,153 $ 9,904 $ 5,225 Attached Single-Family 1 Bedroom 1,538 $ 834 $ 623 $ 6,861 $ 5,180 9,904 $ 2,156 2 Bedroom 2,571 $ 1,391 $ 1,039 $ 6,861 $ 5,180 9,904 $ 3,596 3 Bedroom 3,151 $ 1,672 $ 1,249 $ 7,658 $ 5,180 9,904 $ 4,324 4 Bedroom 4,057 $ 2,198 $ 1,643 $ 7,658 $ 5,180 9,904 $ 4,324 Apartments Efficiency 1,674 $ 905 $ 676 3,180 1 Bedroom 2,273 $ 1,229 $ 918 3,180 2 Bedroom 2,471 $ 1,338 $ 1,000 3,446 3 Bedroom 3,942 $ 2,134 $ 1,594 5,553 PROPOSED SEWER NON-RESIDENTIAL EXISTING CONNECTION FEE NEIGHBORING COMMUNITIES McHENRY McHENRY Meter Size Option 1 Option 2 Algonquin Cary Crystal Lake Lakewood Woodstock 3/4"3,739 $ 1,923 $ 1,437 4,733 4,750 1" 6,252 $ 5,384 $ 4,024 6,153 $ 9,904 $ 4,750 1-1/2" 12,462 $ 9,230 $ 6,898 7,460 $9,466 $ 19,810 $ 9,502 2" 19,942 $ 15,384 $ 11,496 10,832 $ 14,199 $ 39,621 $ 15,440 3" 39,924 $ 34,614 $ 25,866 18,932 $ 89,153 4" 62,377 $ 96,150 $ 71,850 23,665 $ 198,117 6" 124,712 $ 96,150 $ 71,850 28,398 $ 396,238 8" 346,140 $ 258,660 4/13/2020 EXHIBITS BAXTER WOODMAN 1 I I I— i North of ir i I McCullom Lake Road i 1 Imo., I 1 ! i--i l .\\ 1 t' 1 —_ r/ \ r _ I _ t r I 1 I_1 I 1._. I i y 12i and 1-' 1 1 V-- T/ I Martin Road I iC i L I— I - I 1- I II j 1-- 1i r I i 11 i i t I I 11 1 i 1 I 1 ! _f Mt / 1 North of 120 f East of _-1 Chapel Hill I r J f1 / i , as i yIt r South of 120 I - West of y 1 Chapel Hill i l Legend Lakes j South of 1201 i \1 0 ./ ‘.., I I i t ti_ East of I i 1 . I •-\, j 1_._ --- i — Chapel Hill Vi i Legend 1 WVVTP 1Lakes O i Preserves of Part 2 t — I r 1 Boone Creek t 1 , nSi d 1j r-- j R 1 L1 ...-_. 1 1 1ui .r -_ A South of I I -- 1BullValleyv-- -- I and Curran / / i iI_ I - •— I Exhibit A i 3..j ; I 1 __ -- i 1 City of McHenry,Illinois iI , I i ' Proposed Developments I -N I - i Legend Oaks of if - Irish 1 Near Future Developments Prairie 9 East of Distant Future Developments t Cystal I 3 i Lake Road I N t 1 I w J 6AlTEES<I000MA0 1 t t I r c i I -- 1 I r i i D1 1 / "\ I ! J II t 1 -- i -.....i ri WTP4 oy 1 ice IiEIipX1itirilh i. k, a t. a r f**• - v ' Elevated Option 1: Tower 3 Water Treatment Plant WTP 2 li at Well 11 r 4 • , :4/Ai&South of 120 Anew 12"water &West of main extension Chapel Hill jam- - Legend Lakes f an 1 I Southof of I fl f^^ Eaof 1ftalltVAN*Elevated t Chapel Hill Option 2: 1 _ Tower 1 Mgr Water Treatment Plant 111 AI 1 109/7 I : 1 r at Wells 12113 I •. 011110" - AP1*-. i 11.1/ v i Legend WWTP 1 Lakes Part 2 a, ate7 1 Preserves of i Boone Creek y._J J l I 1 I 1__.I Elevated 1 -t A new 12"water( 1 i ITower4 Y main extension Exhibit B I e City of McHenry,Illinois 1 v C ryy Water System t iaipiI _. Legend 1 wi O Elevated Tourers I C Water Treatment Wells Oaksksh f I Backup Wells r Prairie Elevated j Proposed Watermain t II_ I Tower 2 Developments I 000MAN I i i I I i l__ ____i S 1 I I i 1 i II" i1.....*:'-'\._ i t 4 I i Y r 1 i hia, 1 f r- L- i i i L.! 1 II '- Ni g. E south of 120 I 8 West of 4 `, I Chapel Hill I Legend Lakes South of 120 4 j i 8Eastof'' , \ i -`` ` 1 _-.- 1 -- Chapel Hill L., 4111, A"•.,4 7.-/ r= I : ,! I I Lakes 1 — i s--- Preserves of Part 2 i Boone Creek F 1 t , I_ f/ Exhibit C T--- M_ City of McHenry,Illinois I / ---- li E1 Sanitary Sewer System ire W I -i • JJ Legend J I 't i f t -_! - ..`.: 0 Lft Station U I _It—._ .-..a- t J Parades i I4 Sewer Upgrades l ,40 __ 1 Bull Valley Trunk Sewer i I i i S j Oaks of Irish Prairie Trunk Sewer i tittL 11111111,1111111 Route 120 Trunk Sewer j Oaks of 1, i I Irish 4 I—I Bull Valley Tributary 1 Prairie g I I Oaks of Irish Prairie Tributary I r I Route 120 Trunk Sewer Tributary Area i 4 1 // 7/ ri / Developments 4 I t o mo 9 1. 7- so-, 6AAiEN,'?IOODMAN BOo rK t 1 City of McHenry Revenues, Expenditures and Transfers Budget Vs. Actual Year-End FY20-21—(May 1, 2020—April 30, 2021) Overview For the 2020/21 fiscal year all departments were asked to keep the budget status quo as revenues projections were cautiously adjusted based on historical trends as well as taking into consideration the financial instability of the State of Illinois. However,the pandemic hit late in the Fiscal Year and the budget had to be passed as is even though it was apparent that revenue forecasts were not going to be met in Fiscal Year 20-21 before the year even started. With this said, the operating budget for FY20/21 was balanced and staff has already met and reduced the general fund budget by over$1.4 million. All capital spending for projects that have not been started or didn't have defined funding have been put on an indefinite hold and departments have halted all unnecessary spending. Across the United States,the GDP dropped by 32.9%the second quarter of 2020 which is significantly higher than the 5.0%drop in the first quarter of 2020 and even higher than the 2.1%gain in the fourth quarter of 2019. Consumer spending of course drives a lot of this drop in GDP. The national unemployment rate declined to 11.2% in June 2020 from to 14.7%in April 2020 but in February 2020 it was only at 3.5%. The state's unemployment rate was 14.6%in June 2020, 14.7%in May 2020 and McHenry County was at 13.4%in June 2020 and 13.3%in May 2020. On the whole, it will be more important than ever to continue to watch revenue trends as well as spending in order to be able to adjust to the volatile market. The report below gives details on the City's position as ofJuly 31,2020. The report below includes updates to the expense budgets to include the $1.4 million in reductions that have been identified by directors. City Administration will be diligently monitoring the City's financial position on a monthly basis and adjusted budgets have been relayed to all department heads/managers to keep spending low to match anticipated decreases in revenues. Highlights of revenues and expenditures are included below. Budget vs. Actual—Revenues & Expenditures (Refer to Page 5) Overall,out of the City's 30 funds, 27 of the funds are running at levels management would expect for the first quarter of FY20/21. The funds that received property tax receipts are all running over the expected budgeted amount of 25% because approximately% of property tax receipts are received in June. A few funds to highlight that are deviating a little farther than expected are the General Fund, Tourism Fund, and Recreation Center Fund. The General Fund revenues are at 28%of budget, but Sales and Home Rule Sales taxes and Video Gaming revenues are falling short of budget at 20%and 12%of budget respectively. Tourism was significantly affected with the State shutdown and revenues are at only 4.5%of budget. As a reminder,the City has a loan for the Green Street parking lot and payments for this loan are being paid by this fund so the fund balance will have to be watched carefully if revenues do not rebound. Recreation Center Revenues are only at 9.5%of budget as the center was closed all of May and June so monthly fees were captured. Page 1 of 10 Revenues by Type (Refer to Page 6) As of the first quarter,total revenues are at 27%of budget. Property tax revenues are at 48.7%of budget, which is expected since approximately 1/2 of property taxes are received in June. Sales and Use tax revenue was budgeted 2.4 % higher than in FY19/20, but unfortunately with the state shut down State Sales Tax (1% from the state) and Home Rule Sales Tax (.75%) are only at 20% of budget. March State Sales Taxes(1%) received in June are down $76,623 (11.6%)from last year,April taxes received in July are down$131,660(23.2%),and May Sales Taxes received in August(not represented in this report)are down 97,502 (15.5%). Even with unemployment surging, Income tax revenues hit 25% of the budgeted amount. It is anticipated that Income tax revenues will decline later that sales tax revenues due to delayed reporting and payments. Other tax revenue is only at 21% of budget due to the following shortfalls; intertrack wagering taxes are at 5%of budget, hotel/motel taxes are at 6%of budget,and motor fuel taxes are at 20.7%of budget. Water and Sewer sales are above budget at 32.5%, which is positive news with the anticipation that rates will be addressed at the end of the calendar year. As you may recall, during the FY20/21 budget process it was determined that rate increases were necessary to fund operating expenses, but these rate increases were put on hold until the end of the calendar year. Management will continue to watch operating revenues and expenses closely to see if rate increases are needed. Impact fees are at 13.1%of budgeted amounts, but entries have not been made for permits that have already been received. Fines and Fees are only at 11.2%of budget due to all police fines being down and the freeze on water and sewer penalties for the entire quarter. Licenses and permits revenues are at about 19.8% of budget for the quarter. Video Gaming receipts fell short of the budgeted amount at 12% of budget due to the closure that was effective until July. Reimbursement revenues are at about 43% of budget due to billing some dispatch customers for the entire year of service. Charges for Services are at 19.1%of budget primarily due to the Recreation Center and parks revenue. Recreation Center annual membership fees are at 6.5% of budget due to the closing and lost memberships. Interest income is at 0.5%of budget due to entries for interest income not being made yet. Other Revenues are running at 32.4% of budget because employer police pension contributions are paid through property tax collections. Revenues by Fund (Refer to page 7) General Fund revenues amount to 52% of the total budgeted revenues primarily coming from property taxes, sales taxes, income taxes, and charges for services. As of the first quarter, general fund revenues are at 28%of budget, which is a positive position since Sales Tax revenues are below budget. Motor Fuel Tax Revenues are at 20.5% of budget due to decreased demand for gasoline. The Tax Increment Fund revenues are at 53.3%of budget due to approximately% of property tax receipts received. Water/Sewer Revenues are at 29.2% of budget due to higher water usage. Employee Insurance Fund revenues are below budget at 19.3%due to entries for Local 150 insurance not being made as of this report date. Police pension revenues are at 31% of budget due to approximately 1/2 of property taxes collections being received which are used for employer police pension contributions. All other funds' revenues are running Page 2 of 10 at 13.8%for the quarter. These funds are running slightly below budget due to entries not being made as of this report date. Expenditure by Type (Refer to page 8) As an important reminder, the expense budget that is included in this document is the adjusted budget including all the cuts identified by department heads. Total expenditures for the year are at 20.3% of budget primarily due to capital items not being completed during the first quarter and debt service expenses not being paid yet. Salaries represent 30%of the total expenditure budget and are only at 20.6% of the budgeted amount. Benefit expenditures are at 31.4%of the budgeted amount due to 4 months of insurance expenses recorded for Local 150 union employees. Contractual expenses are at 20.4% of budget. Other expenses are running at 18.5% of budget for the quarter due to the development incentive expenses not being paid during the first quarter. Capital expenses are at 6.5% as projects have just been started for the fiscal year. It is important to note that water/sewer fixed assets are recorded and depreciation expense is included in the capital expense category, but depreciation expense is not recorded until the end of the fiscal year. Debt service expenses are at 14.8%of the budgeted amount due to payments being made later in the fiscal year. Expenditure by Fund (Refer to page 9) The total for all of the funds are running at 20.3% of the adjusted budgeted amount for the year. The General Fund is at 24.1%of the budget due to salary expenses falling under budget. The Motor Fuel Tax fund is under budget at 8.7% due to salt being purchased closer to winter and capital project expenses just beginning. The Tax Increment Fund is at 20.8% with % of transfers being made and incentive payments not occurring as of the first quarter. The Water/Sewer Fund expenses are at 15.3% of budget due to IEPA loan payment due dates being later in the fiscal year. The Employee Insurance Fund is at 2% of budget due to premium expenses not being recorded as of this report date. The Police Pension Fund is running at 25%of budget. All other funds are running at 29.1%of budgeted amounts due to%of audit fees being paid for services rendered. Fund Balance (Refer to page 10) The total fund balance (deficit) as of the end of the year is provided on this page. The fund balance is calculated by taking the fund balance (deficit) at 4/30/20 and adding all revenues over expenses received during the first quarter of FY20/21. If there is deficit spending the fund balance will decrease. It is important to note that fund balance is not listed for the Water/Sewer Fund and the Utility Improvements Fund, instead it is better to look at cash and cash equivalents to get an idea of reserves for that fund. Currently, the General Fund has higher revenues than expenses for the first quarter of the fiscal year so the Fund Balance has increased from $7,116,870 to $8,255,056 ($1,138,186). It is important to bring up that it is very early in the fiscal year to look at where fund balance will be and the end of the fiscal year and this could be a very volatile year ahead. The Water/Sewer Fund and Utility Improvements Fund has a combined cash and cash equivalent balance of $4,934,301, but it is important to remember that Page 3 of 10 3,656,442 of this balance is reserved for IEPA loan payments. This only leaves $1,277,859 available for capital programs or operating revenue shortages. Upcoming Quarters In summary, the City has implemented a plan for the budget for FY20/21 to deal with potential revenue shortfalls. Each department was requested to look through their budget and cut expenses where possible and these expense cuts have been included within this budget report. As a reminder, the fund balance and reserve policy was created to help deal with situations like this allowing fund balance to be used in emergency situations. A plan can be created and implemented to rebuild the fund balance over the next few years if needed. Over the next few quarters, management will continue to watch all revenues and expenses and make changes as necessary. Due diligence by all departments will be necessary to ensure spending is controlled as best as possible. Page 4 of 10 City of McHenry Revenues & Expenditures Budget vs. Actual Year-End Report May 1, 2020 - July 31, 2020 Budget Vs.Actual-Revenues&Expenditures Revenues Expenditures 3 Months 20- FY20-21 3 Months 20-21 %of Fund FY20-21 Budget 21 Actual %of Budget Budget Actual BudgetGeneral24,698,778 6,926,130 28.0% 23,995,003 5,787,944 24.1% Tourism 226,000 10,214 4.5% 331,000 27,250 8.2% Pageant 4,000 0.0% 3,900 0.0% Band 12,000 3,000 25.0%14,500 0.0% Civil Defense 6,000 1,500 25.0% 5,300 0.0% Alarm Board 208,000 18,343 8.8%92,000 1,378 1.5% Audit 40,102 16,378 40.8%43,605 25,000 57.3% Annexation 330,000 65,638 19.9% 335,000 8,750 2.6% Motor Fuel Tax 1,141,106 233,400 20.5% 1,370,970 119,249 8.7% Developer Donations 209,000 47,762 22.9% 582,500 476,916 81.9% TIF 702,000 374,055 53.3% 293,835 61,077 20.8% Debt Service 1,087,670 270,045 24.8% 1,089,919 57,420 5.3% Recreation Center 775,585 73,991 9.5% 759,151 120,372 15.9% Special Service Area#1A 0.0% 0.0% Special Service Area#4 16,847 8,078 47.9%16,847 4,212 25.0% Capital Improvements 70,471 29,300 41.6% 104,589 36,550 34.9% Capital Equipment 29,000 7,250 0.0% Water/Sewer 9,597,054 2,926,126 30.5% 10,632,623 1,617,340 15.2% Capital Development 371,500 1,514 0.4% Utility Improvements 41,847 5,432 13.0% Marina 25,500 552 2.2%43,000 12,700 29.5% Employee Insurance 3,339,279 645,480 19.3% 3,338,780 68,356 2.0% Risk Management 744,291 178,794 24.0% 929,503 427,021 45.9% Information Technology 896,589 248,760 27.7% 849,587 135,059 15.9% McHenry Area Character Counts Flex 60,000 11,980 20.0%60,000 0.0% Developmental Escrow 0.0% 0.0% Retained Personnel 75,000 12,078 16.1%75,000 10,765 14.4% Revolving Loan 1,250 1,188 95.0% 0.0% Police Pension 3,921,742 1,214,713 31.0% 2,281,713 570,983 25.0% Total 48,630,611 13,331,701 27.4% 47,248,325 9,568,342 20.3% Net Income/(Loss) Fund FY20-21 Budget 20-21 Actual %of Budget General 703,775 1,138,186 161.7% Tourism 105,000)17,036) 16.2% Pageant 100 Band 2,500) 3,000 Civil Defense 700 1,500 214.3% Alarm Board 116,000 16,965 14.6% Audit 3,503) 8,622)246.1% Annexation 5,000) 56,888 (1137.8%) Motor Fuel Tax 229,864)114,151 49.7%) Developer Donations 373,500) (429,154)114.9% TIF 408,165 312,978 76.7% Debt Service 2,249)212,625 (9454.2%) Recreation Center 16,434 46,381) (282.2%) Special Service Area#1A Special Service Area#4 3,866 Capital Improvements 34,118) 7,250) 21.2% Capital Equipment 29,000 7,250 Water/Sewer 1,035,569) 1,308,786 126.4%) Capital Development 371,500 1,514 0.4% Utility Improvements 41,847 5,432 13.0% Marina 17,500)12,148) 69.4% Employee Insurance 499 577,124 115656.1% Risk Management 185,212) (248,227) 134.0% Information Technology 47,002 113,701 241.9% McHenry Area Character Counts Flex 11,980 Developmental Escrow Retained Personnel 1,313 Revolving Loan 1,250 1,188 95.0% Police Pension 1,640,029 643,730 39.3% Total 1,382,286 3,763,359 272.3% Page 5 of 10 Revenues by Type 3 Months 20-21 Revenues FY20-21 Budget Actual %of Budget %of Total Property Taxes 5,693,632 2,773,953 48.7% 20.8% Sales Taxes 11,057,997 2,227,492 20.1% 16.7% Income Taxes 2,834,160 708,369 25.0% 5.3% Other Taxes 2,022,106 424,863 21.0% 3.2% Water&Sewer Sales 8,182,818 2,659,412 32.5% 19.9% Impact Fees 735,000 96,085 13.1% 0.7% Fines and Fees 652,700 73,258 11.2% 0.5% Licenses and Permits 840,000 166,144 19.8% 1.2% Reimbursements 2,205,773 947,960 43.0% 7.1% Charges for Services 6,971,624 1,332,749 19.1% 10.0% Grants 0.0% 0.0% Interest Income 1,523,100 7,336 0.5% 0.1% Other Revenues 5,911,701 1,914,080 32.4% 14.4% Total 48,630,611 13,331,701 27.4% 100.0% Revenues by Type 14.4% j, 0.1% Property Taxes Sales Taxes 20.8% 0.0% Income Taxes Other Taxes 10.0% Water&Sewer Sales •Impact Fees Fines and Fees Licenses and Permits 7.1% Reimbursements Charges for Services 1.2%6.7% 0.5% 0.7% Grants Interest Income 5.3% 19.9% 3.2%Other Revenues Page 6 of 10 Revenues by Fund 3 Months 20-21 Fund FY20-21 Budget Actual %of Budget %of Total General 24,698,778 6,926,130 28.0% 52.0% Motor Fuel Tax 1,141,106 233,400 20.5% 1.8% Tax Increment Financing 702,000 374,055 53.3% 2.8% Debt Service 1,087,670 270,045 24.8% 2.0% Capital Improvements 70,471 29,300 41.6% 0.2% Capital Equipment 29,000 7,250 0.0% 0.1% Water/Sewer 10,035,901 2,933,624 29.2% 22.0% Employee Insurance 3,339,279 645,480 19.3% 4.8% Risk Management 744,291 178,794 24.0% 1.3% Information Technology 896,589 248,760 27.7% 1.9% Police Pension 3,921,742 1,214,713 31.0% 9.1% All Other Funds 1,963,784 270,150 13.8% 2.0% Total 48,630,611 13,331,701 27.4% 100.0% Revenues by Fund 8,000,000 7,000,000 6,000,000 5,000,000 4,000,000 3,000,000 2,000,000 Revenues by Fund 1,000,000 MINNMIII E E E 6 LL Q E v. 3 S g E a a u E2'Fs ru Page 7 of 10 Expenditures by Type 3 Months 20-21 Expenditures FY20-21 Budget Actual %of Budget %of Total Salaries 13,968,592 2,878,613 20.6% 30.1% Benefits 7,216,015 2,267,903 31.4% 23.7% Contractual 3,882,857 791,463 20.4% 8.3% Supplies 1,527,720 215,687 14.1% 2.3% Other 7,716,093 1,424,005 18.5% 14.9% Debt Service 4,070,467 601,059 14.8% 6.3% Capital 4,189,642 270,374 6.5% 2.8% Transfers 4,676,939 1,119,238 23.9% 11.7% 47,248,325 9,568,342 20.3% 100.0% 3% 12% Expenditures by Type 30% Salaries 6% Benefits Contractual Nr-1 Supplies Other 15% Debt Service Capital Transfers 2% 24% 8% Page 8 of 10 Expenditures by Fund 3 Months 20-21 Fund FY20-21 Budget Actual %of Budget %of Total General 23,995,003 5,787,944 24.1% 60.5% Motor Fuel Tax 1,370,970 119,249 8.7% 1.2% Tax Increment Financinc 293,835 61,077 20.8% 0.6% Debt Service 1,089,919 57,420 5.3% 0.6% Capital Improvements 104,589 36,550 34.9% 0.4% Capital Equipment 0.0% 0.0% Water/Sewer 10,675,623 1,630,040 15.3% 17.0% Employee Insurance 3,338,780 68,356 2.0% 0.7% Risk Management 929,503 427,021 45.9% 4.5% Information Technology 849,587 135,059 15.9% 1.4% Police Pension 2,281,713 570,983 25.0% 6.0% All Other Funds 2,318,803 674,643 29.1% 7.1% Total 47,248,325 9,568,342 20.3% 100.0% Expenditures by Fund 30,000,000 25,000,000 20,000,000 15,000,000 Expenditures by Fund 10,000,000 5,000,000 1 ME Ell IIII General Motor Fuel Tax Tax Increment Debt Service Capital Capital Water/Sewer Employee Risk Information Police Pension All Other Funds Financing Improvements Equipment Insurance Management Technology Page 9 of 10 Fund Balance Fund Revenues Fund Balance/(Deficit) - Over Balance/(Deficit) Fund Description 4/30/20 Expenses 04/30/21 * 100 General Fund 7,116,870 1,138,186 8,255,056 200 Tourism Fund 228,270 (17,036) 211,234 205 Pageant Fund 992) 992) 210 Band Fund 12,583 3,000 15,583 220 Civil Defense Fund 5,836 1,500 7,336 225 Alarm Board Fund 725,658 16,965 742,623 230 Audit Expense Fund 8,248 8,622) 374) 260 Annexation Fund 682,757 56,888 739,645 270 Motor Fuel Tax Fund 1,441,793 114,151 1,555,944 280 Developer Donation Fund 1,487,943 (429,154) 1,058,789 290 TIF Fund 280,603 312,978 593,581 300 Debt Service Fund 4,963 212,625 217,588 400 Recreation Center Fund 420,054 (46,381) 373,673 424 SSA#4 - Lakewood Rd. Utility 83 3,866 3,949 426 SSA#6 - Hunterville 179,115) 179,115) 440 Capital Improvements Fund 478,283 7,250) 471,033 450 Captial Equipment Fund 190 7,250 7,440 510 Water/Sewer Fund ** 5,567,656 1,308,786 6,876,442 550 Capital Development Fund 2,712,611 1,514 2,714,125 580 Utility Improvements Fund ** 633,355) 5,432 627,923) 590 Marina Fund 469,685 (12,148) 457,537 600 Employee Insurance Fund 85,781) 577,124 491,343 610 Risk Management Fund 500,158 (248,227) 251,931 620 Information Technology Fund 135,771 113,701 249,472 700 Employee Flex Fund 720 Developmental Escrow Fund 11,980 11,980 740 Retained Personnel Fund 750 Revolving Loan Fund 276,560 1,188 277,748 760 Police Pension Fund 27,655,865 643,730 28,299,595 Adjustments to Revenues and Expenses for year-end have not been finalized, amounts could change. Cash and Cash Equivalents Page 10 of 10